KEGG   Clostridium perfringens 13: CPE0361Help
Entry
CPE0361           CDS       T00074                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpe  Clostridium perfringens 13
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPE0361 (pfkA)
   01230 Biosynthesis of amino acids
    CPE0361 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPE0361 (pfkA)
   00030 Pentose phosphate pathway
    CPE0361 (pfkA)
   00051 Fructose and mannose metabolism
    CPE0361 (pfkA)
   00052 Galactose metabolism
    CPE0361 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CPE0361 (pfkA)
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPE0361 (pfkA)
Protein phosphatases and associated proteins [BR:cpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPE0361 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461602..462561
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAALRAVTRMALHHGLEVMGVQRGYAGLINGELFKMDRKSVSEI
INRGGTILRTARCLEFKQEEVREKAAQILKAYGVEALVVIGGDGSFMGAKLLSKLGVKTV
GLPGTIDNDLSYTDYTIGFDTALNTVVDAINKLRDTSTSHERVSIVEVMGRNCGDLALYA
GIAGGAEAIIVPEMPFDKDELIKTILEGRTNGKTHSIIVVAEGVGGSAELAKEIESVTGI
ETRATILGHIQRGGSPTADDIVLASRMGAKAVEVLLEGKTSKVIGIKENRIFDMDIDEAL
DIERSFDESLYEMANAINK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgctgttttaacaagtggtggagatgcaccaggaatgaacgctgcctta
agagcggttacaagaatggctttacaccatggacttgaagtaatgggagttcaaagagga
tacgctggattaataaatggagaactattcaaaatggatagaaaatctgtttcagaaatc
ataaacagaggtggtacaatcttaagaactgctagatgtttagaattcaaacaagaagaa
gtaagagaaaaagctgcacaaatattaaaagcttacggtgttgaagctttagtagttata
ggtggagatggatcattcatgggagctaaacttctttcaaaattaggagttaagactgtt
ggattaccaggaacaatcgataacgacttatcttacacagattacactataggatttgat
actgcattaaacacagtagtagatgctataaacaaattaagagatacatcaacttcacac
gaaagagtatctatcgtagaagttatgggaagaaactgtggagaccttgctttatatgct
ggtatcgcaggtggagcagaagctataatagttccagaaatgccatttgataaagatgaa
ttaattaaaactatcttagaaggtagaacaaatggaaaaactcacagcataatagttgtt
gctgaaggagttggaggatcagctgaattagctaaagaaatagaatctgtaactggtata
gaaactagagctacaattttaggtcacatccaaagaggtggatcaccaactgctgatgat
atagtattagcatcaagaatgggagctaaagctgtagaagttttattagaaggaaaaact
tcaaaggttataggaattaaagaaaatagaatattcgatatggatatagatgaagcttta
gatatagaaagaagctttgacgaaagtctttacgaaatggctaacgctataaacaaataa

DBGET integrated database retrieval system