KEGG   Clostridium perfringens 13: CPE0506Help
Entry
CPE0506           CDS       T00074                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00040  Pentose and glucuronate interconversions
cpe00052  Galactose metabolism
cpe00500  Starch and sucrose metabolism
cpe00520  Amino sugar and nucleotide sugar metabolism
cpe01100  Metabolic pathways
cpe01130  Biosynthesis of antibiotics
Module
cpe_M00362  Nucleotide sugar biosynthesis, prokaryotes
cpe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPE0506
   00052 Galactose metabolism
    CPE0506
   00500 Starch and sucrose metabolism
    CPE0506
   00520 Amino sugar and nucleotide sugar metabolism
    CPE0506
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CPE0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAB80212
UniProt: Q8XN32
Position
629121..630041
Genome map
AA seq 306 aa AA seqDB search
MNKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGR
SKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKT
FVGDEPFAILLGDDVVYNEEKPCLKQLIDCYNEYKTSVLGVQTVPESHVSKYGIVDGKHI
EGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILEKTKPGKGGEIQLTDALLELM
GQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGFVEYLNNLSEKESLFKKEVE
KEIVTV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaataagaaaataagaaaagctataataccagcagcaggtcttggtactagattttta
cctgcaacaaaggcacaacctaaggagatgcttccaatagttgataagccaactattcaa
tacataattgaggaagctatagcttcagggattgaagagattcttattattacaggaaga
agcaaaaagtgtattgaggatcactttgataagtcagttgagcttgaaatggagcttgag
aaatcaggtaagaatgaacttttagatttggttagggatatatcagatatggtggatatt
cattatataagacaaaaggagccaagaggacttggacatgctatacattgtgcaaagact
tttgtaggggatgaaccttttgctatactacttggggatgatgtagtttataatgaggaa
aagccatgtttaaaacagttaattgattgttataatgagtataaaactagtgtattagga
gttcaaactgttccagaaagtcatgtttctaaatatggaatagtagatggaaaacatatt
gaaggaaaggtttataaggttaagggattggttgaaaaaccatctgttgaagaagctcct
tcaaatgttgctatattaggaagatacatagtaactccaagaatatttgatattttagaa
aagactaagcctggaaaaggtggagaaattcaattaacagatgctcttctagaacttatg
ggacaagaagcaatgtatgcttatgactttgagggaagaagatatgatgttggagataaa
cttggattcttagaagctactgttgagtatgctttaagaagaccagagcttagagaagga
tttgttgaatatctaaataatttatcagaaaaagaatctttattcaaaaaagaagttgaa
aaagagattgttactgtataa

DBGET integrated database retrieval system