KEGG   Clostridium perfringens 13: CPE0506Help
Entry
CPE0506           CDS       T00074                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpe  Clostridium perfringens 13
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPE0506 (galF)
   00052 Galactose metabolism
    CPE0506 (galF)
   00500 Starch and sucrose metabolism
    CPE0506 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    CPE0506 (galF)
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CPE0506 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
629121..630041
Genome map
AA seq 306 aa AA seqDB search
MNKKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGR
SKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKT
FVGDEPFAILLGDDVVYNEEKPCLKQLIDCYNEYKTSVLGVQTVPESHVSKYGIVDGKHI
EGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILEKTKPGKGGEIQLTDALLELM
GQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGFVEYLNNLSEKESLFKKEVE
KEIVTV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaataagaaaataagaaaagctataataccagcagcaggtcttggtactagattttta
cctgcaacaaaggcacaacctaaggagatgcttccaatagttgataagccaactattcaa
tacataattgaggaagctatagcttcagggattgaagagattcttattattacaggaaga
agcaaaaagtgtattgaggatcactttgataagtcagttgagcttgaaatggagcttgag
aaatcaggtaagaatgaacttttagatttggttagggatatatcagatatggtggatatt
cattatataagacaaaaggagccaagaggacttggacatgctatacattgtgcaaagact
tttgtaggggatgaaccttttgctatactacttggggatgatgtagtttataatgaggaa
aagccatgtttaaaacagttaattgattgttataatgagtataaaactagtgtattagga
gttcaaactgttccagaaagtcatgtttctaaatatggaatagtagatggaaaacatatt
gaaggaaaggtttataaggttaagggattggttgaaaaaccatctgttgaagaagctcct
tcaaatgttgctatattaggaagatacatagtaactccaagaatatttgatattttagaa
aagactaagcctggaaaaggtggagaaattcaattaacagatgctcttctagaacttatg
ggacaagaagcaatgtatgcttatgactttgagggaagaagatatgatgttggagataaa
cttggattcttagaagctactgttgagtatgctttaagaagaccagagcttagagaagga
tttgttgaatatctaaataatttatcagaaaaagaatctttattcaaaaaagaagttgaa
aaagagattgttactgtataa

DBGET integrated database retrieval system