KEGG   Clostridium perfringens 13: CPE0510Help
Entry
CPE0510           CDS       T00074                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpe  Clostridium perfringens 13
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cpe00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cpe00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpe00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpe00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
635095..636039
Genome map
AA seq 314 aa AA seqDB search
MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILVITGR
SKKSIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIYCAKT
FVGDEPFAILLGDDVVYNEEKPCLKQLIDCYNEYRTSVLGVQTVPEENVSKYGIVNGKHI
EGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELM
SEEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLRELSATENIFTEANG
KEKKDKEEELVTEA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaaataagaaaagctataataccagcagcaggtcttggtactagattttta
cctgcaacaaaggctcagcctaaggagatgcttccaatagttgataagccaactattcaa
tacataattgaggaagctatagcttcaggtatagaggaaatacttgttattacaggaaga
agtaaaaaatcaattgaagatcactttgaccgtaatgttgaacttgaaatggaacttgaa
aagtcagggaaaactgaacttttagatttagttagagatatatcagatatggttgatatc
cattatataagacaaaaagaaccaagaggacttggacatgctatctactgtgctaagact
ttcgtaggggatgagccttttgctatattacttggtgatgatgtagtttataatgaagaa
aagccatgcttaaagcaattaattgattgttataatgaatatagaactagtgtattaggg
gttcaaactgttccagaagaaaatgtttctaaatacggaatagttaatggaaaacatatt
gaaggtagagtttataaagtaaaaggcttagttgaaaagccatcaccagaagaagcacct
tcaaatgttgctatattaggaagatatatagtaacgccaagaatatttgatatattagaa
aacacaaaacctggtaaaggtggagaaattcaattaacagatgcacttttagagcttatg
agcgaagaggctatgtatgcttatgactttgaaggaagaagatatgatgtgggagataaa
ttaggattcttagaagctactgttgaatatgctttaagaagaccagatcttagagatggg
tttattgattacttaagagaattatctgctacagaaaatatctttactgaagcaaatggt
aaagaaaaaaaggataaagaagaagagcttgtaacagaagcttaa

DBGET integrated database retrieval system