KEGG   Clostridium perfringens 13: CPE0512Help
Entry
CPE0512           CDS       T00074                                 

Gene name
agaN
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cpe  Clostridium perfringens 13
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CPE0512 (agaN)
  Lipid metabolism
   00561 Glycerolipid metabolism
    CPE0512 (agaN)
   00600 Sphingolipid metabolism
    CPE0512 (agaN)
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CPE0512 (agaN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
637566..639770
Genome map
AA seq 734 aa AA seqDB search
MRIMSINYNENFKTFHLRTKNTSYVLKVMETGHLSHLYWGRKLKVDNLEYFVRRRGFGSF
AADTDNISGFQLELIPQECPTFGATDLRSPSLEFQYEDGTSATDLRYNSHRIYEGKQSLS
GLPAVYVESEEEATSLEITLVDSLKNLEVILTYNVFEDFDAITRSLKIVNNSDEKINIER
VLSANVDFTTDEFDFIQLSGSWGRERHILRNPLRSGSQAIESRRGASSHAQNPFMALCSK
ETNEEYGDVYGFSLVYSGNFLANVEVDMYRNARAQMGINPLDFKWLLESKEEFQAPEVVL
VYSSKGLNGMSQIYHNLYRKRLCRGNYRDKVRPVLINNWEATYFDFNEVKIKEIAKEASK
LGMELFVLDDGWFGNRNDDKSSLGDWFVNENKLKGGLSKLAKDINNMGLEFGLWFEPEMI
SPISKLYEKHPNWCIHIPGRTRSQARSQLILDLSRKEVCDYIIESVSKILESANISYVKW
DMNRNMTEVGSLGLTSERQRETAHRYILGLYRVMEEITSRFPNVLFESCSGGGGRFDPGI
LYYMPQTWTSDDTDAIERLKIQFGTSMVYPQISMGCHVSAVPNHQANRITPLETRGVSAM
AGNFGYELDITKLSEEEKEELKEQISLYKEIRETVQFGTLYRLKSPFNSNEVAWMMISED
KNEIVVSYVRQWALVNESFSNLKLTALDKDSEYEIIGEDIVLSGDELMYIGLNIPELYGD
YVSKLWRLKRKTLK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagaattatgagtataaattataatgagaattttaaaacttttcatctaaggacaaag
aatacaagttatgttttgaaggttatggagacaggacatttaagtcatttgtattgggga
agaaagttaaaagttgataacttagagtattttgttagaagaagaggttttggaagcttt
gcagctgatactgataatataagtggatttcagttagagttaatacctcaagagtgtcca
acctttggagctactgatttaagaagtccaagtttagagtttcaatatgaagatggtaca
tcagctactgatttaagatataattcacatagaatttacgaaggaaagcaaagtctttca
ggtttaccagctgtgtatgttgaaagtgaggaagaggctacttccctagaaataacttta
gttgattctttaaaaaacttagaagtcatattaacatataatgtttttgaagattttgat
gctattacaagaagcttaaaaatagttaataatagtgatgaaaagataaatatagagaga
gttttaagtgccaatgtagattttacaactgatgaatttgattttattcagctttcagga
tcttgggggagagagagacatattcttaggaatcctttaagaagtggaagccaagctatt
gaaagtagaagaggggcaagtagccatgctcaaaatccttttatggccctatgtagtaag
gagaccaatgaagaatatggagatgtttatggctttagcttagtttatagtggaaacttt
ttagccaatgtggaagttgatatgtatagaaatgcaagggctcaaatgggaataaatcct
ttagattttaaatggttacttgagtcaaaggaagagtttcaagcaccagaggttgtatta
gtttattcctcaaagggactaaatggcatgtctcaaatttatcataatctttatagaaag
agattgtgtagaggaaattatagagataaggtaagacctgtgcttataaataactgggaa
gccacatattttgactttaatgaggttaagataaaggaaatagctaaagaagcttcaaag
ctaggaatggaactttttgttcttgatgatggatggtttggaaatagaaatgatgataaa
agttccttaggagattggtttgttaatgagaataaattaaagggtggacttagtaaactt
gctaaggatataaataatatgggcctagagtttggattatggtttgagcctgagatgatt
tcacctattagtaagctttatgaaaagcatccaaattggtgtattcatattccaggaaga
actagatcacaggcaagaagtcagttaatattagacctatcaaggaaagaagtatgtgat
tatataatagaatctgttagtaaaattcttgaaagtgctaatatatcttatgttaagtgg
gatatgaataggaatatgacagaggtgggttctttaggattgacttcagagagacaaaga
gagacagcacatagatatattttaggattatatagggttatggaggaaataacaagtaga
ttccctaatgtattatttgaaagctgctcaggtggcggtggaagatttgacccaggaata
ctttattatatgcctcaaacttggacaagtgatgatacagatgccatagaaagattaaaa
atacagtttggaacctctatggtttatcctcaaatttccatgggatgccatgtctcagca
gttcctaatcatcaagctaatagaataaccccacttgaaactagaggggtatctgccatg
gctggaaactttggatatgagcttgatataactaagttaagtgaggaagaaaaggaagaa
ttaaaggaacaaataagtttatataaagaaattagagaaactgtgcagtttggaactttg
tatagattaaagagcccctttaatagtaatgaagtagcatggatgatgatttcagaagat
aagaatgagattgttgtaagctatgttagacagtgggctttagtaaatgaaagctttagc
aatttaaaacttacagccttagataaggattcagagtatgaaataataggagaagatata
gttcttagtggagatgaacttatgtatataggtttaaacattccagagctttatggagat
tatgtttcaaaactttggagattaaagagaaaaactttaaaataa

DBGET integrated database retrieval system