KEGG   Clostridium perfringens 13: CPE0512Help
Entry
CPE0512           CDS       T00074                                 

Gene name
agaN
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cpe  Clostridium perfringens 13
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cpe00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cpe00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cpe00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
637566..639770
Genome map
AA seq 734 aa AA seqDB search
MRIMSINYNENFKTFHLRTKNTSYVLKVMETGHLSHLYWGRKLKVDNLEYFVRRRGFGSF
AADTDNISGFQLELIPQECPTFGATDLRSPSLEFQYEDGTSATDLRYNSHRIYEGKQSLS
GLPAVYVESEEEATSLEITLVDSLKNLEVILTYNVFEDFDAITRSLKIVNNSDEKINIER
VLSANVDFTTDEFDFIQLSGSWGRERHILRNPLRSGSQAIESRRGASSHAQNPFMALCSK
ETNEEYGDVYGFSLVYSGNFLANVEVDMYRNARAQMGINPLDFKWLLESKEEFQAPEVVL
VYSSKGLNGMSQIYHNLYRKRLCRGNYRDKVRPVLINNWEATYFDFNEVKIKEIAKEASK
LGMELFVLDDGWFGNRNDDKSSLGDWFVNENKLKGGLSKLAKDINNMGLEFGLWFEPEMI
SPISKLYEKHPNWCIHIPGRTRSQARSQLILDLSRKEVCDYIIESVSKILESANISYVKW
DMNRNMTEVGSLGLTSERQRETAHRYILGLYRVMEEITSRFPNVLFESCSGGGGRFDPGI
LYYMPQTWTSDDTDAIERLKIQFGTSMVYPQISMGCHVSAVPNHQANRITPLETRGVSAM
AGNFGYELDITKLSEEEKEELKEQISLYKEIRETVQFGTLYRLKSPFNSNEVAWMMISED
KNEIVVSYVRQWALVNESFSNLKLTALDKDSEYEIIGEDIVLSGDELMYIGLNIPELYGD
YVSKLWRLKRKTLK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagaattatgagtataaattataatgagaattttaaaacttttcatctaaggacaaag
aatacaagttatgttttgaaggttatggagacaggacatttaagtcatttgtattgggga
agaaagttaaaagttgataacttagagtattttgttagaagaagaggttttggaagcttt
gcagctgatactgataatataagtggatttcagttagagttaatacctcaagagtgtcca
acctttggagctactgatttaagaagtccaagtttagagtttcaatatgaagatggtaca
tcagctactgatttaagatataattcacatagaatttacgaaggaaagcaaagtctttca
ggtttaccagctgtgtatgttgaaagtgaggaagaggctacttccctagaaataacttta
gttgattctttaaaaaacttagaagtcatattaacatataatgtttttgaagattttgat
gctattacaagaagcttaaaaatagttaataatagtgatgaaaagataaatatagagaga
gttttaagtgccaatgtagattttacaactgatgaatttgattttattcagctttcagga
tcttgggggagagagagacatattcttaggaatcctttaagaagtggaagccaagctatt
gaaagtagaagaggggcaagtagccatgctcaaaatccttttatggccctatgtagtaag
gagaccaatgaagaatatggagatgtttatggctttagcttagtttatagtggaaacttt
ttagccaatgtggaagttgatatgtatagaaatgcaagggctcaaatgggaataaatcct
ttagattttaaatggttacttgagtcaaaggaagagtttcaagcaccagaggttgtatta
gtttattcctcaaagggactaaatggcatgtctcaaatttatcataatctttatagaaag
agattgtgtagaggaaattatagagataaggtaagacctgtgcttataaataactgggaa
gccacatattttgactttaatgaggttaagataaaggaaatagctaaagaagcttcaaag
ctaggaatggaactttttgttcttgatgatggatggtttggaaatagaaatgatgataaa
agttccttaggagattggtttgttaatgagaataaattaaagggtggacttagtaaactt
gctaaggatataaataatatgggcctagagtttggattatggtttgagcctgagatgatt
tcacctattagtaagctttatgaaaagcatccaaattggtgtattcatattccaggaaga
actagatcacaggcaagaagtcagttaatattagacctatcaaggaaagaagtatgtgat
tatataatagaatctgttagtaaaattcttgaaagtgctaatatatcttatgttaagtgg
gatatgaataggaatatgacagaggtgggttctttaggattgacttcagagagacaaaga
gagacagcacatagatatattttaggattatatagggttatggaggaaataacaagtaga
ttccctaatgtattatttgaaagctgctcaggtggcggtggaagatttgacccaggaata
ctttattatatgcctcaaacttggacaagtgatgatacagatgccatagaaagattaaaa
atacagtttggaacctctatggtttatcctcaaatttccatgggatgccatgtctcagca
gttcctaatcatcaagctaatagaataaccccacttgaaactagaggggtatctgccatg
gctggaaactttggatatgagcttgatataactaagttaagtgaggaagaaaaggaagaa
ttaaaggaacaaataagtttatataaagaaattagagaaactgtgcagtttggaactttg
tatagattaaagagcccctttaatagtaatgaagtagcatggatgatgatttcagaagat
aagaatgagattgttgtaagctatgttagacagtgggctttagtaaatgaaagctttagc
aatttaaaacttacagccttagataaggattcagagtatgaaataataggagaagatata
gttcttagtggagatgaacttatgtatataggtttaaacattccagagctttatggagat
tatgtttcaaaactttggagattaaagagaaaaactttaaaataa

DBGET integrated database retrieval system