KEGG   Clostridium perfringens 13: CPE0551Help
Entry
CPE0551           CDS       T00074                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cpe  Clostridium perfringens 13
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CPE0551 (speB)
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CPE0551 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680183..681040
Genome map
AA seq 285 aa AA seqDB search
MLMNRNVSTFIGCEAEYDESSIVVFGAPFDSTTSFRPGTRFASQVMRGESWGLESYSPYQ
DLDLYDFNIFDGGEIELPFGNSEGALALIEDFSTKVVEDGKIPAMIGGEHLVTLGAFKGV
FKKYPDVHVIHFDAHADLREDYLGQKLSHATVIHRVWDLVGDNKIFQFGIRSGEKEEFLW
AKDHVYTNKFNCDTLDYALERVKDKPVYVTIDLDVLDPSVFPGTGTPEPGGIQFNELLNS
ILKLRGLNIVGFDINELSPQYDQTGASTAVACKVLREMLLVANNK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaatagaaatgtaagcacttttatagggtgtgaagctgaatatgatgaatca
agcatagttgtatttggagctccttttgattcaacaacttcttttagaccaggcactagg
tttgcaagccaagtaatgagaggagaatcttggggattagaaagctatagtccatatcaa
gatttagatctttatgattttaatattttcgatggaggagaaatagagcttccttttgga
aattcagagggagcattagctttaatagaggatttttcaactaaggttgttgaagatggg
aaaataccagctatgataggtggagagcatttagtaactttaggggcatttaaaggagta
tttaaaaaatatcctgatgttcatgtaattcactttgatgctcatgcagatttaagagaa
gattatttaggtcaaaaactatctcatgctactgttatacatagagtttgggatttagta
ggagataataaaatattccaatttggaatacgttctggtgaaaaagaagaatttttatgg
gcaaaggatcacgtttatacaaataagtttaattgtgatactttagattatgccttagaa
agggttaaagataaacctgtttatgtaacaatagacttagatgttttagacccatctgta
ttcccaggtacaggaacaccagaaccaggtggaattcagtttaatgagcttctaaattca
atattaaaacttagagggttaaatattgtgggatttgatattaatgaattatcaccacag
tatgaccaaacaggagcatcaacggctgtagcttgtaaagttttaagagagatgttatta
gtagcaaataacaaatag

DBGET integrated database retrieval system