KEGG   Clostridium perfringens 13: CPE0557Help
Entry
CPE0557           CDS       T00074                                 

Definition
(GenBank) probable glycine betaine/carnitine/choline ABC transporter
  KO
K05847  
osmoprotectant transport system ATP-binding protein
Organism
cpe  Clostridium perfringens 13
Pathway
ABC transporters
Module
Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CPE0557
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    CPE0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
691147..692283
Genome map
AA seq 378 aa AA seqDB search
MIEIKNVSKQIGDRKILDNISLTIDKGSLVVLIGSSGCGKTTTLKLINKLITPTSGEIFI
NEKSLAKENPIELRRNIGYVIQNNGLFPHLTIKENIELIPRLKKGKDVEKIEKTTLDLLN
MVGLDSEIYLNKYPSELSGGQQQRVGFARAFATDAEIILMDEPFSALDPITRTSLQEELF
NIQEELKKTIIFVTHDMDEALKIADKICIMNGGKIAQYDTPENILRNPANDFVRDFIGSD
RVWNNPDFIKAKDIMIKNPVSVKGARTILQGIEIMRSNKVDSLLVIDKENVLKGIVTFKD
IKITNEKSRALSEIMSENPLRVNEDDSLVDILTVMNENSVGFIPVVNSEEKLVGLITRSS
LLSILSDQFLDMEVNIFE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaataaaaaatgtatctaaacaaataggggacagaaagatactagataatatt
tctttaactattgataaaggaagtctagttgttttaataggttctagtggatgtggtaaa
acaactactttaaaacttataaataagttaataacacctacttctggtgaaatatttata
aatgagaaatctttagccaaggaaaaccctattgaattaagaagaaatattggatacgta
attcagaataatggattgtttccacatttaacaataaaggaaaatatagagcttattcca
agactaaaaaagggtaaagatgttgaaaaaatagagaagacaactttagaccttttaaat
atggttggattagattctgaaatttatttaaataagtatccatcagagcttagtggagga
cagcaacagagagtaggttttgcaagagcctttgctacagatgctgagataattttaatg
gacgagccctttagtgctttagatccaataactcgtacttcacttcaggaagagcttttt
aatattcaagaggaacttaaaaagacaattatttttgttactcatgatatggacgaagct
ttaaagatagcagataaaatatgcataatgaatggaggaaaaatagctcaatatgatact
ccagaaaatatacttagaaatccagcaaatgattttgttagagattttataggatcagat
agggtttggaataatcctgacttcataaaagcaaaggatataatgataaaaaatcctgta
tctgttaaaggtgctagaaccatattacaaggaattgaaataatgagaagtaataaggtt
gatagtttattagttattgataaagaaaatgtacttaaaggtattgttacttttaaagat
ataaaaattacaaatgaaaaatcaagagcactttcagaaattatgagtgaaaatccacta
agagttaatgaagatgatagtttagttgatattttaactgtaatgaatgaaaactcagta
ggatttatacctgttgttaactcggaagaaaaattggtagggcttataacaagaagtagt
ttactttcaatattaagcgaccaattcttagacatggaggtgaatatatttgaatag

DBGET integrated database retrieval system