KEGG   Clostridium perfringens 13: CPE0558Help
Entry
CPE0558           CDS       T00074                                 

Definition
(GenBank) probable glycine betaine/carnitine/choline ABC transporter
  KO
K05845  osmoprotectant transport system substrate-binding protein
K05846  osmoprotectant transport system permease protein
Organism
cpe  Clostridium perfringens 13
Pathway
cpe02010  ABC transporters
Module
cpe_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CPE0558
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    CPE0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpuAC BPD_transp_1 Band_3_cyto Spore_Cse60 OSTMP1 SurA_N_3 Arteri_Gl DUF575
Motif
Other DBs
NCBI-ProteinID: BAB80264
UniProt: Q8XMY0
Position
692276..693829
Genome map
AA seq 517 aa AA seqDB search
MNSLLQYVISQKTQILDLLVQHIYLTITAIGIAILIGVPLGILVSRVKFLRKPILGFVNL
VQAVPSMALLGLLIPILGIGSTPAIFMVVVYSLLPIVKNTYTGISGIDPVVLESAKGIGL
TKNQSLFKIQLPLALPIIMSGIRISAVTAVGLMTLAAFIGAGGLGYLVFSGVQTVNNNMI
LAGAIPACILALIVDFIFGKIEVAVTPKGLSNDNKKKNTFVLKIISVIMIIAILFMGISS
FISSRKDKVVIGSKNFTEQLILGNMYADLVQAKTDLQVEKKLNLGGTSVAFGALEKGDVD
MYVDYTGTLLVNVMKENNIDNSVDYYNSIKENMNKEHGLTVMEPLGFNNTYNIAISKELA
DKYKINTISDLSKYSNEFVLSPTIEFQNRQDGLVGLKNYYGMDFKNVKSLDGSLRYSALS
NGESQAIDAFSTDGLLKKFDLKTLEDDKKFFVNYSAVPIVNNKTLEKYPQLKDVLNSLSG
KINEEKMIDLNYEVDVLGKSPEEVAKAFLIREGLIEQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtttattacaatatgtaatttcacagaaaactcaaatattagatttattagtt
caacatatatatttaacaattaccgctataggaatagctatattaataggagttccttta
ggaattcttgtttcaagggtcaaatttttaagaaagcctatactaggatttgtaaactta
gtacaagctgtgccttctatggccttactaggattgcttattcccatattaggaatagga
agtacacctgcaattttcatggttgtagtatattcattgcttccaatagttaaaaatact
tacacaggaatctctggcatagacccagtagtattagaatctgctaagggaattggactt
actaagaaccaaagtttatttaagatacaattaccattagcattgccaataataatgtct
ggtataagaatatcagcagttacagccgtagggcttatgactttagcagcctttattggt
gccggtggacttggatacttagtattctcaggagttcaaacggtaaataataatatgatt
ttagcaggagctataccagcttgtattttagccttaatagttgactttatttttggaaaa
atagaggtagctgttacaccaaagggattaagtaatgataacaaaaagaaaaatactttt
gttcttaaaataataagtgtaataatgataatagctattttatttatgggaatttcatca
tttatatcaagtagaaaagataaagtggttattggatcaaaaaactttactgagcaactt
attttaggaaatatgtatgcagatttagttcaggctaaaacagatttgcaagttgaaaaa
aagctaaatctaggaggaacatcagttgcctttggagcacttgaaaaaggtgatgttgac
atgtatgttgattatactggaacattacttgttaatgttatgaaagaaaataatattgat
aatagtgtagattattataatagcataaaagaaaatatgaataaggaacatgggttaaca
gtaatggaacccctaggttttaataatacttataatatagctatatcaaaagaattagct
gataagtataagataaataccatatcagatttatcaaagtacagtaatgaatttgtatta
tctccaactattgagttccaaaatagacaagatggtttagtaggattaaagaattactat
ggcatggatttcaaaaatgttaaatctttagatggaagtcttagatactcagcattatca
aatggggaatcacaggctatagatgctttctcaacagatggacttcttaaaaagtttgat
ttaaaaactttagaagatgataagaaattctttgtaaattatagtgcagtacctatagtt
aacaataaaactttagaaaaatatccacaattaaaggatgttttaaactctttaagtggt
aagatcaatgaagaaaaaatgattgacttaaactatgaagtagatgtattaggtaaatca
ccagaagaggttgctaaagctttcttaattagagaaggtttaatagaacaatag

DBGET integrated database retrieval system