KEGG   Clostridium perfringens 13: CPE0559Help
Entry
CPE0559           CDS       T00074                                 

Definition
(GenBank) RNA polymerase ECF-type sigma factor
  KO
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
cpe  Clostridium perfringens 13
Brite
Transcription machinery [BR:cpe03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     CPE0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
694087..694662
Genome map
AA seq 191 aa AA seqDB search
MEKTMSISYLDIDRKNELNEIRLIKESMKGNKESFGILIKNNKEYLYKMAFLYVKDEQDA
LEVIHETVYRAFLNIEKLKKAKFFNTWITRILINVSIDFLKKKGKNEMLDESTPIRKERC
EISTEEKLDLYNAIDLLNDNYKTVIIMMYFNDMKIKDISKVMEIPENTVKTYLRRAKQAL
GEVLKEGYLNE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaactatgagtatatcatatctagatatagatagaaaaaatgaattaaatgaa
attagattaataaaagaatcaatgaaaggaaataaagaatcctttggaatccttataaaa
aacaataaagaatacttatacaaaatggcgtttctatatgttaaagatgagcaggatgct
cttgaagttatacatgaaaccgtatatagagcctttttaaatattgaaaaattaaaaaaa
gcaaagttttttaacacatggattacaagaattttaataaatgtatcaattgattttcta
aagaaaaaaggaaaaaatgaaatgttggatgaaagtacaccgataagaaaagaaagatgt
gaaatatccacagaggaaaagttagatttatataatgcaatagatttattaaatgataat
tataaaacagtaataatcatgatgtactttaatgatatgaaaataaaagatatatcaaag
gttatggaaattccagaaaacacagttaaaacttatttaagaagagcaaaacaagcttta
ggtgaggttttaaaggagggctatttaaatgaataa

DBGET integrated database retrieval system