KEGG   Clostridium perfringens 13: CPE0560Help
Entry
CPE0560           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
694655..695743
Genome map
AA seq 362 aa AA seqDB search
MNKKDLDKINLPNNLDDIIDEAINMANEDKKKNKIKGKGYKKVFKNIAAGLAIIIGIGVG
TSTFAYGVPVIKNAFERIQKEIWNKGNYSKYATEVNQTVSNNGVGITLSEILCDGQNLYV
SYVIESKEPFKYIKYKYDPVKDYDITKEQAENIEKMQLDYAAEAKVSFTDSELDNSGVSG
LEGRFIDDHTFVGVEEYNLTSLNMSIPDEFEFIINFNSIVEEGWNERDKRHIFKGEWNFK
VPVKVDKSLSKCIEVNDMNKEGVGIKEVIATPIKLKLVTTGYDREKNNYWVRVYDEKGNI
LRTSSGEELSSYGEYLSTIAKEGEDIKKIKVEIYKPFVDENGKDYFHDPRETILYSKEIN
LE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagacttagataagataaatttaccaaataatttagatgatattatagat
gaggcaataaatatggctaatgaggataaaaagaaaaataaaataaaaggtaaagggtat
aagaaagtatttaaaaatattgcagcaggacttgcaataattattggaattggtgttggt
acaagcacttttgcttatggagtgccagtaataaagaatgcttttgaaagaatacaaaag
gagatatggaataaaggaaattattcaaaatatgcaacagaagttaatcagactgtctct
aataatggggtaggaataactttgtcagagattctttgtgatggacagaatttatatgta
agctatgtaattgaaagcaaagaaccttttaaatatataaaatataaatatgatcctgtg
aaagattatgacataactaaagaacaagcagaaaacattgaaaaaatgcaattagactat
gctgcagaagctaaagtaagttttacggatagtgagttagataatagtggagtttctgga
ttagaaggaagattcatagatgatcatacttttgttggagtagaagagtacaatttaaca
agcttaaacatgagtattccagatgaatttgaatttataataaatttcaattcaatagtt
gaagagggatggaatgagagagataaaagacacatatttaaaggagagtggaattttaaa
gtacctgtaaaagtagataaatctttatctaagtgtatagaagttaatgatatgaataag
gagggtgttggtattaaagaagtaatagcaactccaattaaattaaaattagttactact
ggctatgatagagaaaagaataattactgggtaagagtttatgatgaaaaagggaatata
ttaagaacaagcagtggagaagaattatctagttatggagaatacttatcaactattgct
aaggaaggtgaagatattaaaaaaataaaagttgaaatttataaaccatttgtagatgaa
aatggaaaagattattttcatgatcctagagaaactatattatattctaaggaaataaat
ttagaataa

DBGET integrated database retrieval system