KEGG   Clostridium perfringens 13: CPE0561Help
Entry
CPE0561           CDS       T00074                                 

Definition
(GenBank) PTS system
  KO
K02818  
PTS system, trehalose-specific IIB component [EC:2.7.1.201]
K02819  
PTS system, trehalose-specific IIC component
Organism
cpe  Clostridium perfringens 13
Pathway
Starch and sucrose metabolism
Phosphotransferase system (PTS)
Module
PTS system, trehalose-specific II component
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPE0561
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    CPE0561
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.201  protein-Npi-phosphohistidine---trehalose phosphotransferase
     CPE0561
Transporters [BR:cpe02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Trehalose-specific II component [MD:M00270]
    CPE0561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
696091..697512
Genome map
AA seq 473 aa AA seqDB search
MSKFEKDAKLLTEYIGGKENVAAVTHCATRMRFVLNDTSKADVEKIKAIPCVKGTFTQAG
QFQVIIGPEVATFYNDFVGQTGVSGESKEEVKKAAKKNMNIVQRAVAGLAEIFAPLIPAI
IVGGLILGFRNVIGDMKLFEDGTKSLVEISQFWAGTHSFLWLIGEAIFHFLPVGVVWSIA
KKMGADQMLGIVIGITLVSPQLLNAYSAGNGAAAPVWDFGFAQVPMIGYQAQVLPAIMVG
FTFVYLERLFKKITPGPIQMIIVPFFSVIPTVLLAHTVLGPIGWKIGSVISGVIVAGLTS
SFGWLFAGIFGMIYAPLVITGLHHTLLPVDLQLISDIGGTFLWPIIALSNIAQASAVLAM
IYVNRKDEDEKQISIPACISGYLGVTEPAMFGVNLKYLYPFIASMIGAGVAGMFSMAMGC
MANSVGVGGLPAILSMQSSSMLMYLVAMGIAIVVPFVLTIVFSKTKLANMASK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtttgaaaaagatgcaaagttactaacagagtacataggcggaaaagaaaac
gtagctgcagttactcactgtgctacaagaatgagattcgttttaaatgatacaagcaaa
gcagatgttgaaaaaataaaagctattccttgtgtaaaagggacttttactcaagcagga
cagtttcaagtaataattggaccagaagttgcaactttttataatgattttgttggacag
actggagtatctggagaaagtaaggaagaagtcaagaaggctgccaagaagaatatgaat
atagttcagagagcagttgcaggcttagcagaaatatttgctccattaataccagctatc
atagttggaggtcttatattaggattccgtaatgtaatcggagatatgaaattatttgaa
gatggaactaagagtttagttgaaatttctcaattctgggcaggaacacatagtttctta
tggttaataggagaggcaatattccacttcttacctgtaggagttgtttggtcaattgct
aagaaaatgggagcagatcaaatgctaggaatagttattggtataactttagtatctcca
caattattaaatgcatatagtgcaggtaatggagccgctgctccagtttgggattttgga
tttgctcaagttccaatgataggatatcaagcacaagttttaccagcaatcatggttgga
ttcacttttgtttacttagaaagattatttaagaagattacaccaggacctatacaaatg
ataatagtaccatttttctcagtaattccaacagtattattagcacacactgttttagga
cctataggttggaaaataggtagcgtaatatcaggagttatagtggcaggcttaacatca
tcatttggatggttatttgcaggaatttttggaatgatttatgcaccattagttataaca
ggattacaccatactttattaccagttgatttacaacttataagtgatataggtggaaca
ttcttatggccaataattgcattatcaaatatagctcaagcatcagcagttttagctatg
atatatgtaaatagaaaagatgaagatgaaaaacaaatatcaataccagcatgtatttca
ggatatttaggggtaactgaacctgcaatgtttggggttaacttaaaatatttataccca
ttcatagcctctatgattggagcaggggtagcaggtatgttctcaatggcaatgggatgt
atggcaaactcagtaggagttggtggattaccagcaatcttatcaatgcaatcatctagt
atgttaatgtatttagttgcaatgggaatagcaatagttgtaccattcgtcttaacaata
gtgttctcaaagacaaaattagctaacatggcttcaaaataa

DBGET integrated database retrieval system