KEGG   Clostridium perfringens 13: CPE0563Help
Entry
CPE0563           CDS       T00074                                 

Definition
(GenBank) probable transcriptional regulator
  KO
K03486  
GntR family transcriptional regulator, trehalose operon transcriptional repressor
Organism
cpe  Clostridium perfringens 13
Brite
Transcription factors [BR:cpe03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    CPE0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
699647..700354
Genome map
AA seq 235 aa AA seqDB search
MSSKYLKIYNDIVGKIDSGIFEANTKLPSESQLMDEYNVSRDTVRKSLNLLEQNGYIEKS
KGKGSFVLDMNKFDFPVSGIKSFKEIENSLGKECETILEELTLKSPSDSLMKKLEVSPNK
YVWSVVRVRNIDGEKIILDKDYLNSEFVPRLTEEICKDSLYKYIEGELGLKIAYAEKEIT
VQTATEEDQRLLDLRGYDMVAVVKSYTYLEGRKLFQYTESRHRPDKFKFVDFARR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaagtatttaaaaatatataatgatattgttgggaaaatagatagtggaatt
tttgaagcgaatactaaattaccttcagagtcacaacttatggatgaatataatgtatct
agagatactgtaagaaaatccttgaatttattagagcaaaatggatatattgaaaagtct
aaaggtaagggatcttttgtacttgatatgaataaatttgattttcctgtgtcaggtata
aagagttttaaagagattgaaaatagcttaggaaaagagtgcgaaactatattagaggaa
ttaacattaaaaagtcctagtgatagccttatgaaaaaactagaggtttctcctaataaa
tatgtttggagtgtagtaagagttagaaatatagatggtgaaaagataattttagataag
gactatttaaattcagagtttgttccaagacttacagaagaaatatgcaaggattcttta
tataaatatatagagggagaattaggattaaaaatagcctatgctgaaaaagaaataaca
gtacaaactgctactgaggaagatcaaagacttttagatttaagaggatatgatatggta
gctgtggttaaaagctatacatatttagaaggaagaaaattatttcaatatacagagtca
agacatagaccagataaatttaagtttgtagattttgcaagaagatag

DBGET integrated database retrieval system