KEGG   Clostridium perfringens 13: CPE0564Help
Entry
CPE0564           CDS       T00074                                 

Definition
(GenBank) stage V sporulation protein D
  KO
K08384  
stage V sporulation protein D (sporulation-specific penicillin-binding protein)
Organism
cpe  Clostridium perfringens 13
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CPE0564
Peptidoglycan biosynthesis and degradation proteins [BR:cpe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CPE0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(700806..702992)
Genome map
AA seq 728 aa AA seqDB search
MKRSYRDMAIIRKRLSFILAFIIIMCFILSIRLSYVMIVKGPEYAELAVEQWTNEVKISA
RRGKILDRDLNELAVSSNVYRVDFNLNAIRSYTKKTGKTNEELALEISKVLEMDKDTVLK
KLEFKLPSGAPAGAAILARRIEKEKADKVKELEIPGVMVSPDTQRYYPNDNFLSHVLGTT
NSDGVGLNGIELKYDRVLSGSPGLKITEMVKDGAEYPYTISRFTAPVDGKDVVLTIDEKL
QYFAEQIAEIGLIHHNADAASVIIMNPNNGEILAMSNKPDFNPNKPYDGAENFSGNTSSD
RIQKMWRNRSVSDSFEPGSIFKIITASAAVQEGVAGKDETYTCSGGLQKGDRFIKCWKRG
GHGTQTFEEIIQNSCNVGFMNLGEKLGAEKLNEYIKKFGLGKKSGVDLPGESPGIVKKTE
NITDMDLATISFGQTNTVNPIQFMTAVNAVANGGTLIQPHVVKEISYINENNDRVIDETF
VPKKTENLISKETADQIKLALENAVKNGSAKGAYKEGYGVAGKTGTAQKVNPETGGYGGG
YVASFVGFAPYDNPQISVMVSVDNPKNGEYYGGRVAAPLAGMLLQNIFNYIDLTEFHLDE
KLPEKETVIIPEVRGLPINDTTSMLKELGISYEIEGEGEFIVESNPAPGYPISPDTKITL
IAGDSSNLNSDVIIPDFKNYSKESAEKLLNQLGLIGEFVGEGPSVTKQSISPDEVVNGNS
KITLTLGY
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagatcatatagagatatggccataataagaaaaagactttcgtttatcctagca
tttattataattatgtgttttatactaagcattagattatcttatgtaatgatagttaaa
ggacctgaatatgcagaactagctgttgaacaatggacaaacgaagttaaaatatctgca
agaagaggaaaaatactagatagagatctaaatgagcttgctgttagttctaacgtttat
agagttgacttcaacctaaatgcaattagatcttatacaaagaaaactggaaaaactaat
gaagaattagctttagaaatttctaaggttcttgaaatggataaggatacagttttaaaa
aaattagaatttaaacttccttccggagctcctgctggtgctgcaatccttgctagaaga
atagaaaaagagaaagctgataaagttaaagaattagaaataccaggagtaatggtttct
cctgatactcaaagatactatcctaatgataattttctttctcatgtactaggtactact
aactctgacggtgttggactaaatggtattgagctaaaatatgatagagttttatctgga
agtcctggattaaaaataactgagatggttaaagacggtgctgaatatccttatactatt
tctagatttacagcccctgtagatggcaaagatgtagtcttaacaattgatgaaaaatta
caatactttgctgaacaaatcgctgaaataggtttaatacatcataatgctgatgcagca
tcagtaataataatgaatccaaacaatggtgaaatcttagctatgtctaacaaaccagac
tttaatccaaataaaccttatgatggggctgaaaatttttctggaaatacttcctcagat
agaattcaaaaaatgtggagaaatagatctgtttcagactccttcgaacctggttctatc
tttaagataataacagcttctgctgctgttcaagaaggggtagctggtaaggatgaaaca
tatacctgtagtggtggtctacaaaaaggtgatagattcattaaatgctggaagagaggt
ggacatggcactcaaacctttgaagaaataatacaaaattcatgtaacgttggatttatg
aatttaggagaaaaattaggtgctgaaaaattaaatgaatatattaaaaaatttggtctt
ggaaaaaaatccggtgtagatttacctggtgaatctcctggaatagttaagaaaacagaa
aatataacagatatggacttagcaactatttcttttggtcaaactaatactgttaaccca
attcaattcatgactgcagttaatgcagttgccaatggtggcacattaattcaaccccat
gttgttaaagaaataagttatataaatgaaaataatgatagagttatagatgaaaccttt
gtccctaaaaaaacagaaaatttaataagcaaagaaactgctgatcaaataaaattagct
ttagaaaacgcagtaaaaaatggatcagcaaaaggagcttataaagaaggatatggagtt
gctggtaaaacaggtactgctcaaaaagttaatcctgaaactggtggatatggtggagga
tatgtagcttcctttgttggctttgccccttatgataatccacaaatttctgttatggtt
tctgttgataatcctaaaaatggagaatattatggtggtagagttgcagcacctttagct
ggaatgctactccaaaatatatttaattatatagatttaacagaattccacttagatgaa
aaacttcctgaaaaagaaactgttataattcctgaagttcgtggattacctataaatgat
actacaagtatgctaaaagaattaggtatatcttacgaaatagaaggtgaaggtgaattt
atagttgaaagtaatcctgctcctggctatccaatatctccagatacaaaaataacttta
atagcaggtgatagttcaaacttaaatagtgatgttataattccagactttaaaaactat
tctaaagaatctgctgaaaaacttcttaatcagttaggtcttataggagaatttgttggt
gaaggaccatctgtaactaagcaaagtatttcacctgatgaagttgtaaatggaaattca
aaaattacattaaccttaggatattaa

DBGET integrated database retrieval system