KEGG   Clostridium perfringens 13: CPE0566Help
Entry
CPE0566           CDS       T00074                                 

Definition
(GenBank) riboflavin biosynthesis protein
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00740  Riboflavin metabolism
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
cpe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CPE0566
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CPE0566
Enzymes [BR:cpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     CPE0566
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     CPE0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam YwqJ-deaminase
Motif
Other DBs
NCBI-ProteinID: BAB80272
UniProt: Q8XMX2
Position
704572..705672
Genome map
AA seq 366 aa AA seqDB search
MDEFFMKKALELARKGEGYVNPNPLVGAVIVKDGEIIGQGYHEFFGGNHAEINAINSSIK
STEGATIYVTLEPCCHYGKTPPCVEAIIKNKFKRVVVGTLDPNPLVSGKGIKILRESGIE
VKVGVLEKECIRLNEIFNFYIKENRPFIALKWAMTLDGKIATKEFKSKWITNRKSREFVH
SLRNKYSSIMVGINTVLKDNPDLRCRLNKNKELERKHFRIVLDSKLRIPLDSEILKNQSE
SKTLIFTTNKKDKIKNEKLKDKGIEVIEVNLDEGKININQVLECLKEKNIDSVLIEGGGN
LNFTFLENKKVNKIYAFVAPKVFGGKNAITPVEGEGIRNVLDAFEFPEVNLKNFDKDILI
ECNLSQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttggatgaattttttatgaaaaaagctttggaattagctagaaaaggagagggctatgta
aatccaaaccctttggtaggagctgttattgttaaggatggagaaataataggacaagga
tatcatgagttttttggaggaaatcatgctgaaattaatgctattaatagttctattaaa
tctactgagggagcaacaatatatgttaccttagaaccttgttgtcactatggtaaaact
cctccatgtgtagaggccataattaaaaataaatttaagagagtagtagttggaacctta
gacccaaatcctttggtatcaggaaagggtattaaaattttaagagagtcaggcatagag
gttaaggtaggagttttagaaaaggaatgtattagattaaatgagatatttaatttttat
attaaggaaaatagaccttttattgcacttaaatgggcaatgaccttagatggaaaaata
gcaactaaggaatttaaatcaaaatggataactaatagaaaatcaagagagtttgttcat
tccttaagaaataaatatagctcaataatggttggaataaacactgttttaaaggataat
ccagatttaagatgtagacttaataaaaataaagagttagaaagaaagcattttaggata
gtacttgatagtaaattaagaattcctttagattcagaaatattaaaaaatcaaagtgag
tcaaaaaccttaatttttacaacaaataaaaaggataagataaaaaatgaaaaattaaaa
gataaaggtatagaggtaatagaagtaaatttagatgaaggaaaaattaatattaatcag
gttttagagtgtttaaaagaaaaaaatattgattcagttcttattgaaggaggaggaaat
ttaaattttacttttttagaaaataaaaaagtaaataagatatatgcctttgttgcacca
aaagtttttggagggaaaaatgctattactcccgttgaaggggaaggaataagaaatgtt
ttagacgcctttgaatttcctgaagtaaatttgaagaactttgataaggatattttaatt
gaatgtaaccttagtcaatag

DBGET integrated database retrieval system