KEGG   Clostridium perfringens 13: CPE0568Help
Entry
CPE0568           CDS       T00074                                 

Definition
(GenBank) riboflavin biosynthesis protein
  KO
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cpe  Clostridium perfringens 13
Pathway
Riboflavin metabolism
Folate biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CPE0568
   00790 Folate biosynthesis
    CPE0568
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CPE0568
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CPE0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
706550..707695
Genome map
AA seq 381 aa AA seqDB search
MVIVIDDEGRENEGDLVMAGELVTGEKINFMATYGKGLICAPVSESIAENLGLNPMVSHN
TDNHETAFTVSIDYKDTTTGISAFERAHTIKELINEESKAEYFRRPGHVFPLIAKNGGVL
KRDGHTEAAIDLAKLAGLKEVGVICEIMKDDGTMARTDELLEFAKIHNMKIITIEDLIAY
RTERDNFVYRVVETNMPTKYGDFKAIGFIDKLTGEHHVALVKGEIKSEEPVLLRVHSECL
TGDVFGSRRCDCGEQFHSAMEKINEEGKGILLYMRQEGRGIGLINKLKAYKLQDEGLDTV
EANIALGFPEDLRDYGVGAQILKDLGVREIRLMTNNPKKITGLEGYGLKIVERVPIEIKC
NEENEFYLKTKKEKMHHLIMQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggttattgttattgatgatgagggaagagaaaatgagggggatctagttatggctgga
gaacttgttactggagaaaaaataaattttatggctacttatggaaagggtttaatatgt
gctccagtaagtgagagcatagctgaaaatttaggattgaatcctatggtttcacataat
acagataatcatgaaactgcatttacagtatctatagattataaagatacaactacagga
atatcagcctttgaaagggctcatacaattaaagaattaataaatgaagaaagtaaagca
gagtattttagaagaccaggacatgtattccctttaatagctaagaatggtggcgtttta
aagagagatgggcatacagaggcagcaattgacttagcaaagttagctggattaaaagaa
gttggggtaatatgtgaaataatgaaagatgatggaactatggctagaactgatgaatta
ttagaatttgcaaagattcataatatgaaaataataactatagaagatttaattgcttat
agaacagaaagagataattttgtttatagagttgttgaaactaatatgccaactaaatat
ggagattttaaggctattgggtttatagataaacttacaggagagcatcatgtggcttta
gttaaaggagagataaaatcagaggagccagtattattaagagtgcattcagagtgttta
actggagatgtttttggatcaagaagatgtgattgtggagagcagtttcatagtgctatg
gaaaaaataaatgaagagggaaaaggaatattactttatatgagacaagaaggaagagga
ataggtcttataaataagttgaaagcttataagcttcaagatgaaggattagatactgta
gaagctaatatagccttgggatttccagaagatcttagagattatggcgttggagcacaa
attctaaaagatttaggtgtaagggaaatcaggttaatgactaataatcctaaaaaaata
actggcttagagggatatggacttaaaatagtagaaagagtacctatagaaataaagtgt
aatgaggaaaatgagttttatttgaaaactaagaaagagaaaatgcaccatttaataatg
cagtaa

DBGET integrated database retrieval system