KEGG   Clostridium perfringens 13: CPE0578Help
Entry
CPE0578           CDS       T00074                                 

Definition
(GenBank) probable ABC transporter
  KO
K10202  
N-acetylglucosamine transport system permease protein
Organism
cpe  Clostridium perfringens 13
Pathway
ABC transporters
Module
N-Acetylglucosamine transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CPE0578
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   N-Acetylglucosamine transporter [MD:M00205] [OT]
    CPE0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
719139..719882
Genome map
AA seq 247 aa AA seqDB search
MSSFKTTKEFYASPWALPKSFGFANYMTAFTEANMGAYFFNSILVTIIAMVLSLCLSVPA
SYVLARQKFFGCSFIKNLFMAGLFIQPVYIIVPLFTILEKMKLLNNLFALALVYAVLSLP
FSIYIMSGFMKGIAKDYEEAAMIDGCTNLQILTKIVVPLAKPGIITIMIFNFMNYWNEYA
MAMTFITDADKKTLPVGLQNLMEVQKFATDWGALFAGLVIVMVPTMVIYSLVHKKLTEGV
NIGGVKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttttaaaactactaaagaattctatgcaagtccatgggccttaccaaaaagt
tttgggtttgctaactatatgactgcatttacagaagctaacatgggagcttacttcttc
aactcaatattagttactataatagctatggttttatccctatgtttaagtgtaccagca
tcttatgttttagctagacaaaagttctttggatgtagttttataaagaatctatttatg
gcaggattatttattcaaccagtatatattatagtacctttatttacaatattagaaaaa
atgaaactgttaaataatttatttgcattagctcttgtatatgcagtgctaagcttacct
ttctcaatctatataatgagtggatttatgaaggggattgcaaaggattatgaagaggca
gcaatgatagatggatgtactaatcttcaaatattaacaaagatagtagttccattagct
aaaccaggtattataactataatgatattcaactttatgaattattggaatgaatatgct
atggcaatgactttcataacagatgcagataaaaagacattaccagtagggttacaaaac
ttaatggaagttcaaaagtttgcaactgactggggagcattatttgcaggattagttata
gtaatggtacctacaatggttatatactcactagttcataagaagttaacagaaggtgtt
aatattggtggagttaagggctaa

DBGET integrated database retrieval system