KEGG   Clostridium perfringens 13: CPE0580Help
Entry
CPE0580           CDS       T00074                                 

Definition
(GenBank) probable iron-sulfur binding reductase
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
720785..721915
Genome map
AA seq 376 aa AA seqDB search
MRKEVKMTNKELKKNLEDCVNCGLCYKVCPMMNTFGESPKNILRDIDENKISYDEIAYSC
MLCNACTESCPKDINLKEMFQNLRIKSYRENLKNTSKKFNLKVVQNHQKGSFSKFLTSKN
NHKKIKRVFIPGCSLSGYNNEIIFKIKDYLIENLGEVEILLKCCGKPSKDIGNLELFESN
LNDIENNLKIKEVDEIIVACENCYKTFGSAFKDIKVITLWEVINEFGVPKELKNKYSDLK
EEFALHDPCPIKKEEQIHEAVRSILKDLGIKIVEFEKNRSKTECCGCGGMVGVTNKELWL
SQKNERANSTECENIVSYCESCVNTFKSSDKNALHILDFIFNEDVINGKAKSQKNISTIN
QWINRIKLANKVGKES
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagaggtaaaaatgacaaataaggaactaaagaaaaatttagaggactgtgtt
aattgtggactttgctacaaggtatgtccaatgatgaatacttttggagagagtcctaaa
aatatattaagagatatagatgagaataaaataagttatgatgaaattgcatattcttgt
atgctttgtaatgcatgtactgaatcatgtccaaaagatataaatttaaaagagatgttt
caaaatttaagaataaaatcttatagagagaatttaaaaaatactagcaagaaatttaat
ttaaaggttgttcaaaatcatcaaaaaggtagtttttctaagtttttaacatcaaaaaat
aatcataagaaaataaagagagtgtttattccaggttgtagcttaagtggatataacaat
gaaattatttttaaaataaaggactacttaatagaaaatttaggggaagtagagatactt
ctaaaatgttgtggaaagccttcaaaggatattggaaacttagaattatttgaaagtaat
ttaaatgatatagagaataatctaaaaatcaaggaagttgatgaaataatagtagcctgt
gaaaattgttataagacttttggatcagcttttaaagatattaaagtaataacactttgg
gaagttataaatgaatttggagttccaaaggaactaaaaaacaaatattcagatttaaaa
gaagaatttgccttgcatgatccatgtcctataaaaaaagaagaacaaattcacgaagct
gttagaagcatacttaaagatttaggaattaaaatagtagaatttgagaagaatagaagt
aaaactgaatgctgtggttgtggaggaatggtaggagttacaaataaggaattatggcta
agtcaaaaaaatgaaagagctaattctacagaatgtgaaaatatagtttcttactgtgaa
tcctgcgtaaatacctttaaatcttcagataaaaatgcactacacatattagactttatt
tttaatgaagatgttattaatggcaaagctaaaagtcaaaagaatataagcacaattaat
caatggataaatagaattaaattagcaaacaaagtaggaaaagagagttaa

DBGET integrated database retrieval system