KEGG   Clostridium perfringens 13: CPE0585Help
Entry
CPE0585           CDS       T00074                                 

Definition
(GenBank) fructose-1-phosphate kinase
  KO
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cpe  Clostridium perfringens 13
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CPE0585
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     CPE0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(726902..727822)
Genome map
AA seq 306 aa AA seqDB search
MIYTLTLNPSIDYVIDVENLELGKVNRTSNDFKFPGGKGINVSRILGNQKIDNIALGFLG
GFTGKFIEDNLKALGVKTEFIKVKGDSRINVKIKSNEETEINGAGPMITSEELDSLFNRL
DQLVEGDILVLAGSIPSTLPKDLYLQIQKRVSKKNVKVVVDTSGKALLEAIKNKPFLIKP
NNHEIEEIFDVKINSEKELIKYGKDLVSLGAENVIISMAGDGALLITKDGVFKGNAPKGE
VKNSVGAGDSLVGGFLAKYVETKDLIASFKNGIASGSASAFSLDLALAEDVNKLLPIIKI
EKYEEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatttatactcttactcttaatccatctattgactatgtaatagatgtagaaaactta
gagctaggaaaagtaaacagaacaagtaacgattttaaatttcctggcggaaaaggaatt
aatgtttcaagaattttaggaaatcaaaaaatagataatatagcccttggattccttggt
ggatttactggtaagttcattgaagataatctaaaggctttaggagtaaaaacagaattt
ataaaagtaaaaggtgattcaagaattaatgtaaaaattaaatctaatgaagaaacagaa
ataaacggtgctggtccaatgataacatctgaagaattagactcactgtttaatagattg
gatcaattagtagaaggagatatattagttcttgcaggtagtattccatctactcttcct
aaagatttataccttcaaatacaaaagagagtttctaagaaaaatgtaaaggttgtagtt
gatacttctgggaaagctcttttagaagctataaaaaataaaccttttttaataaaacca
aataatcatgaaattgaagaaatatttgatgtgaaaataaattctgagaaagaacttatt
aaatatggaaaagatttagtttctcttggagcagaaaacgtaataatctctatggctgga
gatggagctctattaataactaaggatggtgtattcaaaggaaacgcacctaaaggagaa
gttaaaaattctgtaggagctggcgactctttagtaggaggtttcttagcaaaatatgtt
gaaactaaagatttaattgcttccttcaaaaatggaatagcctcaggaagtgctagtgca
ttttctctagatttagctcttgctgaagatgtcaataaattattaccaattataaaaatt
gaaaaatatgaggaggtttaa

DBGET integrated database retrieval system