KEGG   Clostridium perfringens 13: CPE0590Help
Entry
CPE0590           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
731757..733070
Genome map
AA seq 437 aa AA seqDB search
MKQKSKKYLKYISRNNTFLLGKTFLKWLLIGSLIGIFIGGVIAIFLKSLEWATDYRVNHG
FVLFLLPIGGALVSFLYYKFGRNSVKGNNLIIENINNYCGDVPLRMVPLVFFGTVVTHFF
GGSAGREGTGVQIGASIAETIGKLLKLNKEDSKIMLMAGVSGGFSAIFGTPLAGTIFGLE
VSVLGKMSYEALIPSFFASIVGNEVVKILGVHHSHYKVLGVADISVLIILKVIISAICFG
LASRLFSELTHKLKGLFSNKFKNTSLKSFVGGCIVILLVYLVGSRKYLGLSLPLLSEAFN
GHVSPFDFLGKLIFTSITLGAGYQGGEVTPLFVIGSTLGNTLSGILNLSPSFLASLGLVG
VFAGATNTPIASFVLGIEMFGVGGAPYLFMACAISYIFSGHTGIYTSQKIGVSKSNLINF
SHDSTLASLSKREEVKL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaatctaagaaatatttaaagtatattagtagaaataatacctttcttcta
ggaaagacatttttaaagtggctattaataggaagtttaataggaatttttataggagga
gtaatagctatatttttaaaatctttagaatgggcaactgattacagagttaatcatggc
tttgttttatttttacttcctattggtggagccttagtaagctttctatactacaagttt
ggaaggaactcagtaaaaggtaataatttaattattgaaaatataaataattattgtgga
gatgtaccacttcgcatggttcccttagttttctttggaacagttgtaactcactttttt
ggaggatcagcaggtagggaaggaactggagtacagattggtgcaagtatagcagagact
ataggaaagttgttaaaattaaataaggaagattcaaagataatgcttatggcaggggta
agtggaggattctcagctatatttggtacaccgcttgctggaactatatttggattagaa
gtctctgtattaggtaaaatgagttatgaagctttaataccaagtttctttgctagtatt
gtgggaaatgaggttgttaaaatcttaggagtgcatcattctcattataaggttttggga
gtggcagatatctcagttcttattattttaaaagtaataatttcagcaatttgttttgga
ctagctagtagattatttagtgaacttacacataaattaaaaggtctattttctaataag
tttaagaatacctcattaaaaagctttgtaggaggatgtattgtaatattattagtttat
ttagtaggaagtagaaaatatttaggtttaagtcttcctttattatcagaagctttcaat
ggacatgtatcaccttttgattttctaggaaaacttatttttacatcaataactttaggt
gctggatatcaagggggagaagtaactcctttatttgttattggatcaaccttaggaaat
acattatcaggaatattaaatttatcaccttcatttttagcttctttagggttagtaggt
gtatttgcaggagcaactaatacgcctattgcttcttttgttttaggaatagagatgttt
ggagtaggaggtgcaccatatttatttatggcgtgcgcaataagttatatcttctcagga
catactggaatatatacttctcaaaaaataggagtaagtaagagtaatttaataaatttt
tctcatgattcaactctcgcatcattgagtaaaagggaagaggtaaaactatag

DBGET integrated database retrieval system