KEGG   Clostridium perfringens 13: CPE0591Help
Entry
CPE0591           CDS       T00074                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cpe  Clostridium perfringens 13
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPE0591
   00330 Arginine and proline metabolism
    CPE0591
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CPE0591
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CPE0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
733374..734297
Genome map
AA seq 307 aa AA seqDB search
MDINLDALVEANRRYTKEGHVATYIPALAKVNPDQLGVCIYDLKENKEFSAGEYDVRFAI
ESISKVPTLILAILDNGIEKVFSEVGTEPSGFAFNSIMNMQINHKNKPSNPFINAGAIKV
VSLLKGKNDEERFKRILDFYRKIMNDDEITLDTEIYLSERETGDINRSLAYYMKGNGIME
GDVTDILDSYFKQCSVLVTAKDLARLGAVLANEGVMPWNGERLFSVETATVVKSLMTTYG
LYDESGAFSVHIGLPSKSGVGGGILSSVPNKCGIGLFSPALDVSGNSVASMKLLKEIADK
LKLDIFR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggatataaatttagatgctttagtagaagctaatagaagatatacaaaagaaggacat
gtagctacatatattccagcccttgcaaaggtaaatccagatcaattaggtgtttgtatt
tatgatttaaaagaaaataaagaattttcagctggagaatatgatgttaggtttgcaatt
gaaagcatatcaaaggttcctacattaatattagctatattagataatggaatagaaaaa
gtattttcagaagttggaacagaaccttctggatttgcttttaattcaattatgaatatg
caaataaatcataaaaataaaccatcaaacccatttattaatgcaggagctattaaagta
gtatccttacttaaagggaaaaatgatgaagaacgttttaaaagaattttagatttttat
agaaagattatgaatgatgatgaaattactttagatactgaaatatatttatcagaaaga
gaaacaggtgatataaacagatctcttgcttattatatgaagggtaatggaatcatggaa
ggtgatgttactgatattttagattcatattttaaacaatgttcagttttagttacagct
aaggatttagcaagattaggtgctgtattagctaatgaaggggttatgccttggaatggt
gaaagattattttctgtagaaacagctactgttgttaaatcattaatgactacttacgga
ttatatgatgaatcaggagctttttcagttcatattggactaccatctaaaagtggtgta
ggaggaggaatattatcttcagttcctaataaatgtggtataggattatttagtccagct
ttagatgtatcaggaaatagtgttgctagtatgaaacttctaaaggaaatagcagataaa
ttaaaattagatatatttagatag

DBGET integrated database retrieval system