KEGG   Clostridium perfringens 13: CPE0593Help
Entry
CPE0593           CDS       T00074                                 

Definition
(GenBank) sugar fermentation stimulation protein
  KO
K06206  
sugar fermentation stimulation protein A
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
741120..741812
Genome map
AA seq 230 aa AA seqDB search
MKYNSVIRKAIFLRRPNRFQAYVVLDDEELLVHVPNTGRCREILKEGCTVLLRKGTTPNR
KTPYDLIAAYKGEVLINIDSQIPNKVVEEALRNKKIEKLVNFNNISREKTFGNSRFDFKL
QDDNENTYFLEVKGVTLEENGETRFPDAPTERGKKHILELIEIKKLGMGAGIIFLIQIDN
VNKFSPNDETDPKFGEALRLAKKEGVDIFAYNCKVTEEEIELLNSVEIVL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacaatagtgttatcagaaaagctatttttttaagaagaccaaatagatttcaa
gcttatgtagttttagatgatgaggagttattagttcatgtccctaacactggaaggtgt
agagagattttaaaagaaggatgtacagttcttttaagaaaaggaactactccaaataga
aaaactccgtatgatttaattgcagcttataagggtgaggttttaataaatatagattct
cagattcctaataaagttgtagaagaggcattaagaaataaaaagatagaaaagctagta
aattttaataatataagtagagaaaaaacttttggaaattctagatttgattttaaatta
caagatgataatgaaaatacatactttttagaagtaaaaggggtaactttagaggaaaat
ggagagactaggtttccagatgctccaactgaaagaggaaagaaacacatattagaactg
attgaaattaaaaaattaggaatgggtgcaggaataatttttttaatacagatagataat
gtaaataagttttctcctaatgatgaaacagatcctaagtttggggaagcattgagatta
gctaaaaaagaaggagtagatatctttgcatataattgcaaagttactgaagaggaaatt
gagttgcttaattctgtagaaatagtgttataa

DBGET integrated database retrieval system