KEGG   Clostridium perfringens 13: CPE0595Help
Entry
CPE0595           CDS       T00074                                 

Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
cpe  Clostridium perfringens 13
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CPE0595
Enzymes [BR:cpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     CPE0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
743070..744470
Genome map
AA seq 466 aa AA seqDB search
MFLCCFYLLELNARRVGSFAYFYTLPLKKFVEGKDMKLFGSMKVEENELYVGGVKASALS
KEYGTPLYVIDEELVRSNCRRYYNAMKCEEIGNRVTYAGKAFINMSMCNLVNEENLYLDV
VSGGELYTAYKAGFPLERIYFHGNNKSDYEIDLGVRLGIGRFIVDNIHELEVLNSIAQEY
GRVQKVYLRITPGVEAHTHEYIKTGQLDSKFGFPVIGDTVYDAIKRAMELEYIELNGLHC
HIGSQIFDLEPFEDTTEIMLNLINDIKETLGYEIKELDLGGGFGIYYTEGDKPKEIEEYC
SVIINKADEICRKLNMNVPILSIEPGRSIVGNAGLTLYTVGAIKEIPNIRKYVSVDGGMS
DNIRPALYSANYESLIANRVFDNSKEIVTVAGKCCESGDVLLNSIEMPRMETGDILAIMS
TGAYGHSMANNYNRIPKAAVVSVSNGISKVMCKRETYEDLLRNECF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctttgctgtttttatttattggaattaaatgccaggagagtcggtagctttgca
tacttttatactctgccactaaaaaagtttgtggagggaaaagatatgaaattatttgga
tcaatgaaagtagaagaaaatgagttatatgttggaggagtaaaagcaagtgctttaagc
aaggaatatggaactcctttatatgttattgatgaagagttagtgagaagcaattgtaga
agatactataatgctatgaagtgtgaagaaataggaaacagagttacctatgcaggaaag
gcatttataaatatgtccatgtgcaatttagttaatgaagaaaatttatatttagatgtt
gtttcaggtggagagctttatactgcttataaagcaggtttcccattagaaagaatatat
ttccatggtaacaataaatctgattatgaaatagatttaggagtaagattaggaattgga
agatttatagttgataatattcatgaactagaagttcttaattctatagctcaagaatat
ggaagagttcaaaaagtttatttgagaataactcctggagtagaggcccatacccatgaa
tatataaaaacaggtcaattggactcaaaatttggattccctgtaattggtgatacagtt
tatgacgctattaaaagagcaatggaattagagtatatagaacttaatggattgcattgt
catataggttcgcaaatatttgacttagaaccttttgaagatacaacagaaattatgcta
aatcttataaatgatataaaagaaaccttaggatatgaaataaaagaattagacttaggt
ggaggatttggtatatattacactgaaggagataagccaaaagaaatagaagaatattgt
tcagttataataaataaagctgatgaaatatgcagaaagttaaatatgaatgttcctata
ttaagtatagagccaggaagaagtattgtagggaatgcaggattaactctttatactgta
ggagctataaaagaaattcctaatataagaaaatatgtaagtgtagatggtggaatgagt
gataatataagaccagccttatacagtgcaaattatgaatcattaatagctaacagagtt
tttgataattctaaggagatagttactgtggcaggaaaatgctgtgaatcaggggatgta
cttttaaattctatagagatgcctagaatggaaactggagatatattagctataatgtct
acaggagcatatggacattcaatggctaataattataatagaatccctaaggcggcagtt
gtaagtgtaagtaatggaatttcaaaagttatgtgtaaaagagaaacttatgaagatttg
cttagaaatgaatgtttttaa

DBGET integrated database retrieval system