KEGG   Clostridium perfringens 13: CPE0595Help
Entry
CPE0595           CDS       T00074                                 

Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00300  Lysine biosynthesis
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
cpe01120  Microbial metabolism in diverse environments
cpe01130  Biosynthesis of antibiotics
cpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CPE0595
Enzymes [BR:cpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     CPE0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Motif
Other DBs
NCBI-ProteinID: BAB80301
UniProt: Q8XMU3
Position
743070..744470
Genome map
AA seq 466 aa AA seqDB search
MFLCCFYLLELNARRVGSFAYFYTLPLKKFVEGKDMKLFGSMKVEENELYVGGVKASALS
KEYGTPLYVIDEELVRSNCRRYYNAMKCEEIGNRVTYAGKAFINMSMCNLVNEENLYLDV
VSGGELYTAYKAGFPLERIYFHGNNKSDYEIDLGVRLGIGRFIVDNIHELEVLNSIAQEY
GRVQKVYLRITPGVEAHTHEYIKTGQLDSKFGFPVIGDTVYDAIKRAMELEYIELNGLHC
HIGSQIFDLEPFEDTTEIMLNLINDIKETLGYEIKELDLGGGFGIYYTEGDKPKEIEEYC
SVIINKADEICRKLNMNVPILSIEPGRSIVGNAGLTLYTVGAIKEIPNIRKYVSVDGGMS
DNIRPALYSANYESLIANRVFDNSKEIVTVAGKCCESGDVLLNSIEMPRMETGDILAIMS
TGAYGHSMANNYNRIPKAAVVSVSNGISKVMCKRETYEDLLRNECF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgttcctttgctgtttttatttattggaattaaatgccaggagagtcggtagctttgca
tacttttatactctgccactaaaaaagtttgtggagggaaaagatatgaaattatttgga
tcaatgaaagtagaagaaaatgagttatatgttggaggagtaaaagcaagtgctttaagc
aaggaatatggaactcctttatatgttattgatgaagagttagtgagaagcaattgtaga
agatactataatgctatgaagtgtgaagaaataggaaacagagttacctatgcaggaaag
gcatttataaatatgtccatgtgcaatttagttaatgaagaaaatttatatttagatgtt
gtttcaggtggagagctttatactgcttataaagcaggtttcccattagaaagaatatat
ttccatggtaacaataaatctgattatgaaatagatttaggagtaagattaggaattgga
agatttatagttgataatattcatgaactagaagttcttaattctatagctcaagaatat
ggaagagttcaaaaagtttatttgagaataactcctggagtagaggcccatacccatgaa
tatataaaaacaggtcaattggactcaaaatttggattccctgtaattggtgatacagtt
tatgacgctattaaaagagcaatggaattagagtatatagaacttaatggattgcattgt
catataggttcgcaaatatttgacttagaaccttttgaagatacaacagaaattatgcta
aatcttataaatgatataaaagaaaccttaggatatgaaataaaagaattagacttaggt
ggaggatttggtatatattacactgaaggagataagccaaaagaaatagaagaatattgt
tcagttataataaataaagctgatgaaatatgcagaaagttaaatatgaatgttcctata
ttaagtatagagccaggaagaagtattgtagggaatgcaggattaactctttatactgta
ggagctataaaagaaattcctaatataagaaaatatgtaagtgtagatggtggaatgagt
gataatataagaccagccttatacagtgcaaattatgaatcattaatagctaacagagtt
tttgataattctaaggagatagttactgtggcaggaaaatgctgtgaatcaggggatgta
cttttaaattctatagagatgcctagaatggaaactggagatatattagctataatgtct
acaggagcatatggacattcaatggctaataattataatagaatccctaaggcggcagtt
gtaagtgtaagtaatggaatttcaaaagttatgtgtaaaagagaaacttatgaagatttg
cttagaaatgaatgtttttaa

DBGET integrated database retrieval system