KEGG   Clostridium perfringens 13: CPE0598Help
Entry
CPE0598           CDS       T00074                                 

Definition
(GenBank) cell division protein
  KO
K03798  
cell division protease FtsH [EC:3.4.24.-]
Organism
cpe  Clostridium perfringens 13
Brite
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     CPE0598
Peptidases [BR:cpe01002]
 Metallo Peptidases
  Family M41: FtsH endopeptidase family
   CPE0598
Chaperones and folding catalysts [BR:cpe03110]
 Other chaperones and cochaperones
  AAA proteases
   CPE0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
745703..747856
Genome map
AA seq 717 aa AA seqDB search
MFKDKKMLKYIVIYSIIAFGILLTFNMVKDEMLYEKVDYSTFMQMLDKKEVKSVNFSGNQ
IEITPSDSSNLKGKILYTTNPAVAGITQPDLIKDLTAAGVGFNVTKPENYQLLGLLMSWV
FPLILIFFVGRMMFSKMNNKMGGGVMSFGKNNAKLYAENETGITFKDVAGQDEAKESLVE
IVDFLHDTRKYVEIGAKLPKGALLVGPPGTGKTLLAKAVAGEAKVPFFSMSGSDFVEMFV
GMGAARVRDLFKQAEEKAPCIVFIDEIDAIGKSRDGAIQGNDEREQTLNQLLTEMDGFDS
SKGVVILAATNRPEVLDKALLRPGRFDRRIIVDRPDLIGREEILKVHSRDVKLSDDVSLE
EIAKSTPGAVGADLANIVNEAALRAVKHGRKFVIQEDLDEAVEVIIAGQEKRDRILSPKE
KKIVAYHEVGHALVAALLNNTDPVHKITIVPRTMGALGYTMQLPEEEKYLVSKEEMIDQI
SVMLGGRAAEEVVFNSITTGASNDIERATQSARNMITIYGMSERFDMMALEAMSNRYLDG
RPVRNCSETTAAIADEEVLQVIKKAHEKSIKILIENRELLDEITGVLLDKETIMGDEFME
IVYSKYPEKREADEKAKKEIQSLREQALAKRKEKEEAIKKAREEALRLEEEQRKQAELKA
MIEAQEEAAKLARANNEANNDDLDSSKENEEVKSNVNDRATEEKKDDSSTNNKVDGE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagataaaaaaatgcttaaatatattgtcatatatagtattatagcgtttggt
atattattaacctttaatatggttaaagatgaaatgctatatgaaaaagtagattatagc
actttcatgcaaatgttagataaaaaagaagttaaatcagtaaacttttcaggaaatcaa
attgagataacaccttcagatagcagtaatttaaaaggaaaaatcttatatacaactaat
ccagcagttgctggtattactcaaccagatttaattaaagatttaactgcagctggggta
ggattcaatgtaactaaaccagaaaactatcaacttttaggtttattaatgtcatgggtt
ttcccgttaatacttatattctttgttggtagaatgatgttctctaaaatgaataataaa
atgggtggaggagtaatgtcatttggtaaaaataatgctaagctttatgctgaaaatgag
actggaataacatttaaagatgttgcaggtcaagatgaagctaaagaatccttagtagaa
attgtagactttttacatgatacaagaaaatacgtagaaataggagctaagcttccaaag
ggtgctttattagtagggcctccaggaacaggtaaaactttacttgctaaggctgttgca
ggagaagcaaaagtaccatttttctctatgtcaggttcagacttcgttgaaatgtttgta
ggtatgggagctgcgagagtaagagatttattcaagcaagcagaagaaaaagctccatgt
atagttttcatagatgagattgatgctattggtaagagtagagatggtgctattcaagga
aatgatgaaagagaacaaactcttaaccaattattaactgagatggatggtttcgattct
tcaaaaggggttgttattttagcagctacaaatagaccagaagttttagataaagcttta
ttaagaccaggtagatttgatagaagaataattgttgatagaccagatttaataggtaga
gaggaaatattaaaggttcactctagagatgttaaattatcagatgatgtatctttagaa
gaaatagcaaaatctactccaggtgctgttggggcagacttagcaaacatagttaatgaa
gctgctttaagagctgtaaaacatggaagaaagtttgtaattcaagaagacttagacgaa
gctgttgaagttataatagcaggtcaagaaaagagagatagaatactttcaccaaaagaa
aagaaaatagttgcatatcatgaagtaggtcacgcattagttgcagctttattaaataat
actgacccagttcataagataacaatagttcctagaacaatgggagctttaggatacaca
atgcaacttccagaggaagaaaaatacttagtatctaaggaagaaatgatagatcaaata
tcagttatgcttggtggtagagcagcagaggaagtagtatttaatagtataactactggt
gcatcaaatgatattgaaagagctactcaatcagctagaaatatgataactatttatggt
atgagtgagaggtttgatatgatggctttagaagctatgagtaatagatacttagatgga
agaccagttagaaactgttcagaaactactgctgccatagctgatgaagaagttttacaa
gttattaaaaaagctcatgaaaaatcaattaagattttaattgaaaatagagagttatta
gatgagataacaggtgttcttttagataaagaaactatcatgggtgacgaattcatggaa
atagtttatagtaaatatccagaaaagagagaagctgatgaaaaggctaagaaggaaatt
caaagtctaagagagcaagctttagctaagagaaaagaaaaagaagaagcaatcaaaaaa
gctagagaagaagcattaagattagaagaagagcaaagaaaacaagctgaattaaaagct
atgatagaagctcaagaagaggctgcaaaattagcaagagctaataatgaagctaacaat
gatgatttagactcatctaaagaaaatgaagaagttaaatctaatgttaatgatagagct
acagaagaaaagaaagatgatagctctacaaataataaagttgacggtgaatag

DBGET integrated database retrieval system