KEGG   Clostridium perfringens 13: CPE0601Help
Entry
CPE0601           CDS       T00074                                 

Definition
(GenBank) probable amino acid ABC transporter
  KO
K02029  
polar amino acid transport system permease protein
Organism
cpe  Clostridium perfringens 13
Module
Putative polar amino acid transport system
Brite
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    CPE0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
751519..752190
Genome map
AA seq 223 aa AA seqDB search
MGGLDFSFLKEYFPVFLEGAKWTLIISAITVILGALLGTILCFMKRSKFSIFKVKILRVI
STAYVEVIRGTPLLLQIYIVYFGLPSFGIQLEVLLSCIIAISLNSAAYVSEIIRAGIDAV
DKGQLEAARSLGMTEGMAMRLIILPQAIKNILPAIGNEFVAIIKESSMASTIGVAELMYS
SKIVTGATYKGFEPLIVIAMFYFVMTFSLGRVMSYVEKRLSKS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggggggattagacttcagctttttaaaagagtattttccagtatttttggaaggtgct
aaatggacattaataatttcagcaataacagttattttaggagctttattaggaacaatt
ttatgctttatgaaacgttccaaattttcaatatttaaagttaaaattttaagggttatt
tctactgcttatgtagaagttataagaggaacacctcttttattacaaatatatatagtt
tattttggattaccttcctttggaattcaattagaggttttactttcatgtattattgct
atttccttaaattcagcagcttatgtttcagaaataataagagcagggatagatgctgtt
gataagggacaattagaagccgctagaagtttaggtatgacagaaggaatggctatgaga
cttataatacttcctcaagctataaaaaatatactccctgctataggaaatgagtttgtt
gccataataaaggaatcatctatggcatctacaattggagtagcagaacttatgtattca
tcaaaaatagttacaggggctacttataaaggttttgaaccacttattgttatagcaatg
ttttattttgttatgacctttagtttaggaagagttatgtcttatgtagaaaagaggttg
agtaaatcatga

DBGET integrated database retrieval system