KEGG   Clostridium perfringens 13: CPE0608Help
Entry
CPE0608           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(761995..762189)
Genome map
AA seq 64 aa AA seqDB search
MSKKYPPRDRDFYSPEKHDLVSYSKTGKTYTKLPNPLEDDIVCNNISYSEFDYIEGDMLD
DDDI
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaatatcctccaagagatagagacttttatagtccagaaaaacatgattta
gtttcttattctaaaactggtaaaacttacactaaattgccaaacccattagaagatgac
atagtttgcaacaatatatcctatagtgaatttgactatatagaaggcgatatgctagac
gacgatgatatttaa

DBGET integrated database retrieval system