KEGG   Clostridium perfringens 13: CPE0610Help
Entry
CPE0610           CDS       T00074                                 

Definition
(GenBank) probable membrane protein
  KO
K06994  putative drug exporter of the RND superfamily
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL LUC7 WXG100 IncA HAUS-augmin3 ATG16 Mucin APG6 Apolipoprotein Tektin Myosin_tail_1 Spc7 FAM184 DUF3053 KELK Muted
Motif
Other DBs
NCBI-ProteinID: BAB80316
UniProt: Q8XMS8
Position
complement(763637..766966)
Genome map
AA seq 1109 aa AA seqDB search
MKDNILKKIKLNKPLSFFILIIWCAVVAFLFLTAPSLSKLVSEKGGIQLPDDYSSKISDI
LQSDNKFNSKDSYIAVFHSSNKLTDENLKNIKDTIDRLKSKENSDYIQSINDSFDTPQLK
NQLNSENGKTIIALMTVNPKDSSVSTIEKTLNDELKTPGVETYVTGQSLIENDVNVAAQK
GLNKTQTITVIFIFIVLILLFKSVVTPFIPLLTVGISYLGAQSVVGILADKFNFPLSNYT
QIFMICIMFGIGTDYSILLLNRFKEELANGNNRLDSVKITFKTAGKTVLSSATPVFVVFA
SLNFIGFNLYRSAVAVAIGILFLIAALFTIFPAVMIILGKNIFWPVKGTFKAEENRLWAK
LANKAFSKPIPILGAIFTILLLPILFNNFHQSFNNLNEIGDTYSAKEGFNIIADDFGIGQ
ASPVSIYIENDDDMRKPEYVALIEKLSNNLQNSSNDIKSVLSVTRPTGVRLDEIYVNDQA
GQVSQGIDKANNGLNKINEGLSDASKKIDSSKSKLKGAEEGTAKLQEGTKKTETGVSELQ
SALNKLVESIREEHNGATELKDSIDGALDKVNSLKLSKSQLEEDYSAIVNSANDVLENLN
KIGSLTGNPNSVNVDTSKLKESLSSLNSHLSEYSKSHPEVLNDENFKKFSDDINNLNNNS
NNLQGTFNNTPEIKAINESIGALKVLINTLNSKKDTVINDLDKFNSGISEIENGLKALDS
GLGKSLAGGEEISSKVPEISNALNQIANGQSKIQDGFKEFSGQINELSNGLEAGSNGLTE
IQNGLKYANGFINDWSNLSYNLSGICVPIEVFSNDEFKKSLNQYMSSDGKLAVINVITTK
NPYSNEAVNEIPNLKSLVQDGVKGTKLENANIGIGGMASTTYETKRMADSDYDKALIFVI
VGVFITLIIILRSLTMPIYLMISLLLTYFTSISVIQFVVTKIMGYPGISWITSFFGFVVL
MALGIDYSIFIMTRFNQDLNGSIKDRIIRTMKSMGGVIISAVIILSGTFAALLPSGVLSL
IEISMVVLTGILLYVVFVLPLFIPAMVKIFGKANWWPFKPALSKEDKSLDDSTTIVTTVV
TTTTTTTTTTKNGSSTITKKESKTTTTKE
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataatatacttaaaaagattaaacttaataaaccacttagcttttttatttta
ataatatggtgtgcagttgtagcatttttatttttaactgccccttccctatcaaagcta
gttagtgaaaaaggaggaatacaattacctgatgattattcttctaaaatttcagacata
ctccaatcagataataaatttaatagcaaagatagctatatagctgtttttcactcaagt
aataaattaacagatgaaaatctaaaaaatataaaggatactattgatagattgaaatca
aaagaaaatagtgattatattcaaagtataaatgatagttttgatactcctcagctaaaa
aatcaacttaactctgaaaatggtaaaactattatagccttaatgacagtaaatccaaag
gattcctctgtaagtacaatagaaaaaactttaaatgatgaattaaaaactccaggggtt
gaaacctatgttacaggacaaagtcttatagagaatgatgttaatgtggctgcacaaaaa
ggactaaataaaactcaaacaataactgtaatatttatattcatagtccttatattattg
tttaaatcagtagttactccatttattcctttacttactgtaggaataagttatttagga
gctcaatctgttgttgggattttagcagataagtttaattttcctctttcaaactacact
caaatatttatgatttgtataatgttcggtattggaactgattactctattttgctactt
aatagatttaaagaggaattagctaatggaaataatagacttgattctgtaaaaataacc
tttaaaactgctggtaaaacagttttatctagtgctaccccagtatttgttgtttttgca
tccttaaattttattggatttaatttatatagaagtgccgtggctgtagcaattggtata
ttatttttaattgcagccttatttacaattttcccagctgtgatgattatattaggaaag
aatattttctggcctgttaaaggaacctttaaagcagaagaaaatagactttgggctaag
ttagctaataaagcatttagtaaaccaattcctatactaggagctatattcaccatactt
ttacttcctattttatttaataactttcatcaatcatttaacaatttaaatgagattggt
gatacttactctgctaaggaaggatttaatataatagcagatgactttggtataggacaa
gcatctcctgtttcaatatacatagaaaatgatgatgatatgagaaaacctgaatatgta
gccttaatagaaaaactttctaataatctacaaaactctagtaatgatataaaatcagta
ttaagtgttactagaccaacaggagttcgtcttgatgaaatttatgtaaatgaccaagct
ggtcaagtttcacaaggtatagataaagcaaataatggattaaacaaaataaatgaagga
ttaagtgatgctagtaaaaaaatagattcatcaaaaagcaagttaaaaggggctgaagaa
ggtacagctaagcttcaagaaggtactaaaaaaactgaaactggggtttctgaacttcaa
agtgctcttaataaacttgtggaaagtattcgtgaagaacataatggtgccacagaatta
aaagattccatagacggtgccttagataaagttaattctttaaaactaagtaaatctcaa
cttgaagaagattatagtgccatagttaattctgctaatgatgttcttgaaaatttaaac
aaaattggttccttaacaggtaatccaaattcagttaatgtagatactagtaaacttaaa
gaatctctttcatcattgaattctcatttaagtgaatattcaaagtcacatccagaggtt
ttaaatgatgaaaatttcaaaaaattctctgatgatattaataatttaaataataactct
aataatttacaaggaacttttaataatactccagagattaaagcaataaatgaaagcata
ggtgcattaaaagttttaataaacactttaaatagtaaaaaggatactgtaataaatgat
ttagataaatttaattctggaatttctgaaattgaaaatggattaaaggctttagatagt
ggtcttggcaaatccttagcagggggagaagaaatttcatctaaagttcctgaaatttca
aatgccttaaaccaaatagctaatggtcaatctaaaatccaagatggtttcaaagaattt
tctggccaaataaatgaattatctaatggacttgaggctggttctaatggattaactgaa
attcaaaatggtcttaagtatgctaacggatttataaatgattggtcaaatctatcttat
aatctttcaggaatttgtgttccaattgaggtatttagtaatgatgaatttaaaaaatcc
ctaaatcaatatatgagctcagatggtaaattagcagtaataaatgtaattactacaaag
aatccttattccaatgaagcagttaatgaaattcctaatcttaaatctcttgttcaagat
ggagttaaaggaactaagttagaaaacgctaatataggtattggtggaatggctagtaca
acatacgaaactaaaaggatggctgactctgattatgataaagctttaatatttgtaata
gttggagtatttattaccttaattattatattaagatctttaacaatgccaatttactta
atgatttctttattactaacttattttacttcaataagcgtaatacaatttgttgtcact
aaaatcatgggatatccaggtatatcatggataacatcattctttggttttgtagtttta
atggctttaggtatagattattcaatatttataatgacaagatttaaccaagatcttaat
ggttccataaaggatcgtataataagaacaatgaaaagtatgggtggagtaataatatct
gccgtaataatccttagtggtacctttgcagccttacttccatctggagtattatcatta
attgaaatttccatggtggttctaacaggcatacttttatatgttgtatttgttcttcct
ctatttattccagcaatggtaaaaatatttggaaaggcaaattggtggccatttaaacca
gccttatcaaaagaagataaaagtttagatgattccactactattgttacaacagtggtc
acaactactaccacaactaccactacaactaaaaatggttcttctaccataacaaaaaaa
gaatccaaaacaactacaaccaaggaataa

DBGET integrated database retrieval system