KEGG   Clostridium perfringens 13: CPE0610Help
Entry
CPE0610           CDS       T00074                                 

Definition
(GenBank) probable membrane protein
  KO
K06994  
putative drug exporter of the RND superfamily
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(763637..766966)
Genome map
AA seq 1109 aa AA seqDB search
MKDNILKKIKLNKPLSFFILIIWCAVVAFLFLTAPSLSKLVSEKGGIQLPDDYSSKISDI
LQSDNKFNSKDSYIAVFHSSNKLTDENLKNIKDTIDRLKSKENSDYIQSINDSFDTPQLK
NQLNSENGKTIIALMTVNPKDSSVSTIEKTLNDELKTPGVETYVTGQSLIENDVNVAAQK
GLNKTQTITVIFIFIVLILLFKSVVTPFIPLLTVGISYLGAQSVVGILADKFNFPLSNYT
QIFMICIMFGIGTDYSILLLNRFKEELANGNNRLDSVKITFKTAGKTVLSSATPVFVVFA
SLNFIGFNLYRSAVAVAIGILFLIAALFTIFPAVMIILGKNIFWPVKGTFKAEENRLWAK
LANKAFSKPIPILGAIFTILLLPILFNNFHQSFNNLNEIGDTYSAKEGFNIIADDFGIGQ
ASPVSIYIENDDDMRKPEYVALIEKLSNNLQNSSNDIKSVLSVTRPTGVRLDEIYVNDQA
GQVSQGIDKANNGLNKINEGLSDASKKIDSSKSKLKGAEEGTAKLQEGTKKTETGVSELQ
SALNKLVESIREEHNGATELKDSIDGALDKVNSLKLSKSQLEEDYSAIVNSANDVLENLN
KIGSLTGNPNSVNVDTSKLKESLSSLNSHLSEYSKSHPEVLNDENFKKFSDDINNLNNNS
NNLQGTFNNTPEIKAINESIGALKVLINTLNSKKDTVINDLDKFNSGISEIENGLKALDS
GLGKSLAGGEEISSKVPEISNALNQIANGQSKIQDGFKEFSGQINELSNGLEAGSNGLTE
IQNGLKYANGFINDWSNLSYNLSGICVPIEVFSNDEFKKSLNQYMSSDGKLAVINVITTK
NPYSNEAVNEIPNLKSLVQDGVKGTKLENANIGIGGMASTTYETKRMADSDYDKALIFVI
VGVFITLIIILRSLTMPIYLMISLLLTYFTSISVIQFVVTKIMGYPGISWITSFFGFVVL
MALGIDYSIFIMTRFNQDLNGSIKDRIIRTMKSMGGVIISAVIILSGTFAALLPSGVLSL
IEISMVVLTGILLYVVFVLPLFIPAMVKIFGKANWWPFKPALSKEDKSLDDSTTIVTTVV
TTTTTTTTTTKNGSSTITKKESKTTTTKE
NT seq 3330 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataatatacttaaaaagattaaacttaataaaccacttagcttttttatttta
ataatatggtgtgcagttgtagcatttttatttttaactgccccttccctatcaaagcta
gttagtgaaaaaggaggaatacaattacctgatgattattcttctaaaatttcagacata
ctccaatcagataataaatttaatagcaaagatagctatatagctgtttttcactcaagt
aataaattaacagatgaaaatctaaaaaatataaaggatactattgatagattgaaatca
aaagaaaatagtgattatattcaaagtataaatgatagttttgatactcctcagctaaaa
aatcaacttaactctgaaaatggtaaaactattatagccttaatgacagtaaatccaaag
gattcctctgtaagtacaatagaaaaaactttaaatgatgaattaaaaactccaggggtt
gaaacctatgttacaggacaaagtcttatagagaatgatgttaatgtggctgcacaaaaa
ggactaaataaaactcaaacaataactgtaatatttatattcatagtccttatattattg
tttaaatcagtagttactccatttattcctttacttactgtaggaataagttatttagga
gctcaatctgttgttgggattttagcagataagtttaattttcctctttcaaactacact
caaatatttatgatttgtataatgttcggtattggaactgattactctattttgctactt
aatagatttaaagaggaattagctaatggaaataatagacttgattctgtaaaaataacc
tttaaaactgctggtaaaacagttttatctagtgctaccccagtatttgttgtttttgca
tccttaaattttattggatttaatttatatagaagtgccgtggctgtagcaattggtata
ttatttttaattgcagccttatttacaattttcccagctgtgatgattatattaggaaag
aatattttctggcctgttaaaggaacctttaaagcagaagaaaatagactttgggctaag
ttagctaataaagcatttagtaaaccaattcctatactaggagctatattcaccatactt
ttacttcctattttatttaataactttcatcaatcatttaacaatttaaatgagattggt
gatacttactctgctaaggaaggatttaatataatagcagatgactttggtataggacaa
gcatctcctgtttcaatatacatagaaaatgatgatgatatgagaaaacctgaatatgta
gccttaatagaaaaactttctaataatctacaaaactctagtaatgatataaaatcagta
ttaagtgttactagaccaacaggagttcgtcttgatgaaatttatgtaaatgaccaagct
ggtcaagtttcacaaggtatagataaagcaaataatggattaaacaaaataaatgaagga
ttaagtgatgctagtaaaaaaatagattcatcaaaaagcaagttaaaaggggctgaagaa
ggtacagctaagcttcaagaaggtactaaaaaaactgaaactggggtttctgaacttcaa
agtgctcttaataaacttgtggaaagtattcgtgaagaacataatggtgccacagaatta
aaagattccatagacggtgccttagataaagttaattctttaaaactaagtaaatctcaa
cttgaagaagattatagtgccatagttaattctgctaatgatgttcttgaaaatttaaac
aaaattggttccttaacaggtaatccaaattcagttaatgtagatactagtaaacttaaa
gaatctctttcatcattgaattctcatttaagtgaatattcaaagtcacatccagaggtt
ttaaatgatgaaaatttcaaaaaattctctgatgatattaataatttaaataataactct
aataatttacaaggaacttttaataatactccagagattaaagcaataaatgaaagcata
ggtgcattaaaagttttaataaacactttaaatagtaaaaaggatactgtaataaatgat
ttagataaatttaattctggaatttctgaaattgaaaatggattaaaggctttagatagt
ggtcttggcaaatccttagcagggggagaagaaatttcatctaaagttcctgaaatttca
aatgccttaaaccaaatagctaatggtcaatctaaaatccaagatggtttcaaagaattt
tctggccaaataaatgaattatctaatggacttgaggctggttctaatggattaactgaa
attcaaaatggtcttaagtatgctaacggatttataaatgattggtcaaatctatcttat
aatctttcaggaatttgtgttccaattgaggtatttagtaatgatgaatttaaaaaatcc
ctaaatcaatatatgagctcagatggtaaattagcagtaataaatgtaattactacaaag
aatccttattccaatgaagcagttaatgaaattcctaatcttaaatctcttgttcaagat
ggagttaaaggaactaagttagaaaacgctaatataggtattggtggaatggctagtaca
acatacgaaactaaaaggatggctgactctgattatgataaagctttaatatttgtaata
gttggagtatttattaccttaattattatattaagatctttaacaatgccaatttactta
atgatttctttattactaacttattttacttcaataagcgtaatacaatttgttgtcact
aaaatcatgggatatccaggtatatcatggataacatcattctttggttttgtagtttta
atggctttaggtatagattattcaatatttataatgacaagatttaaccaagatcttaat
ggttccataaaggatcgtataataagaacaatgaaaagtatgggtggagtaataatatct
gccgtaataatccttagtggtacctttgcagccttacttccatctggagtattatcatta
attgaaatttccatggtggttctaacaggcatacttttatatgttgtatttgttcttcct
ctatttattccagcaatggtaaaaatatttggaaaggcaaattggtggccatttaaacca
gccttatcaaaagaagataaaagtttagatgattccactactattgttacaacagtggtc
acaactactaccacaactaccactacaactaaaaatggttcttctaccataacaaaaaaa
gaatccaaaacaactacaaccaaggaataa

DBGET integrated database retrieval system