KEGG   Clostridium perfringens 13: CPE0611Help
Entry
CPE0611           CDS       T00074                                 

Definition
(GenBank) peptide-chain-release factor RF-3
  KO
K02837  
peptide chain release factor 3
Organism
cpe  Clostridium perfringens 13
Brite
Translation factors [BR:cpe03012]
 Prokaryotic Type
  Release factors
   CPE0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(767227..768822)
Genome map
AA seq 531 aa AA seqDB search
MSDLIKEIEKRRTFAIISHPDAGKTTLTEKFLLYGGAIRMAGSVKARKAATHAVSDWMEI
EKQRGISVTSSVMQFNYGGYCINILDTPGHQDFSEDTYRTLMAADSAVMVIDGAKGVEDQ
TRKLFQVASLREIPIFTFVNKMDRETRDPFQLLEDIESELGIKSYPMNWPIGCGSHFKGV
YDRATNTIHLFDGGNHGQSEVSTITGDLEDPKFKELLGEDLHNKLMEDVELLDIAGDEFD
LEKVRKGELTPAFFGSALTNFGVEPFLNDFLKLTTSPLPRNSSIGEIDPMTEPFSAFVFK
IQANMNKAHRDRLAFMRICSGKFEKGKDVFHVQGGKKVKLAQPQQFLAQDREVVEEAYAG
DIIGVFDPGIFSIGDTLCLNPKKFKFEGIPTFAPEHFARVKPVDTMKRKQFIKGVTQIAQ
EGAIQVFKELHIGMEEIIVGVVGVLQFEVLEYRLKNEYNVDIKMERLPFRYVRWIENDNI
DVDSLNLTSDTKKVKDFKDRNLLIFQNDWGISWAIDHNPGIILSGVGKSND
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgatttaattaaggaaatagagaaaagaagaacctttgccatcatatctcaccct
gatgctggtaaaactactcttactgaaaaattcttactttatggaggagctattagaatg
gctggttctgtaaaggctagaaaagctgctacacacgcagtttctgactggatggaaata
gaaaagcaaagaggtatctctgttacttcatctgttatgcaatttaactatggtggatat
tgtataaatatactagatactcctggtcaccaagacttctcagaggatacatatagaaca
cttatggctgccgactcagctgttatggttatagatggagctaaaggggttgaggatcaa
acaagaaaattattccaagttgcttcattaagagaaattcctatatttacttttgtaaac
aaaatggatagagaaactagagatccattccaacttctagaagatattgaaagtgaactt
ggtataaaatcttacccaatgaattggccaataggatgtggaagtcactttaaaggtgtt
tatgatagagctacaaacacaatacatttatttgatggtggaaaccatggacaaagtgag
gtttcaactataactggtgacttagaagatcctaaatttaaagaacttctaggtgaagat
ttacataataagttaatggaagatgttgaactattagatatagctggtgacgaatttgat
ttagagaaagttagaaaaggagaattaactcctgcattctttggatcagctcttacaaac
tttggagttgagccatttttaaatgacttcttaaaactaactacttctccacttccaaga
aattcatcaataggtgaaatagatcctatgactgaaccattctcagctttcgtatttaaa
atacaagctaacatgaataaagctcatagagatagacttgctttcatgagaatatgttct
ggtaaatttgaaaaaggaaaagatgttttccacgttcaaggtggtaagaaggttaaactt
gctcaacctcaacaattcttagctcaagatagagaggttgttgaagaagcttacgctgga
gatatcataggtgtatttgacccaggtatattctcaataggagatactttatgtttaaat
cctaagaaattcaaatttgaaggtattcctacatttgctcctgaacactttgctagagtt
aaacctgtagatactatgaaaagaaaacaattcataaaaggtgttactcaaatagctcaa
gaaggtgctattcaggtatttaaagaattacacatcggtatggaagaaatcatagttggt
gttgttggtgttcttcaatttgaagttttagaatatagattaaaaaatgaatacaatgtt
gatataaaaatggaaagacttccatttagatatgttagatggattgaaaatgataatata
gatgtagattcactgaacttaacttctgatacaaagaaagttaaagattttaaagataga
aatctacttatattccaaaatgactggggtatttcatgggctatagatcacaaccctgga
ataatactttcaggtgttggtaaatctaacgactaa

DBGET integrated database retrieval system