KEGG   Clostridium perfringens 13: CPE0612Help
Entry
CPE0612           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(769036..769641)
Genome map
AA seq 201 aa AA seqDB search
MPVRIAILGGPRCGKTTLIQQLYVEFKIRGLDVGAATEYSTEYLKEKGMIETISEQYGIY
LGQLRLEESLNQFDYALTDYATFVPYIYGRFMLGDKKRSEKEIEILKDLYHLALKDLQKY
DHIFFVPREFGYTQDGVRWQDESTASAVDNALKQFLDSENVKYTTIEGSTKDRARQILSI
VGLDNKDALPTMRELKKKNSK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgccagttagaattgcaatacttggtggtccaagatgtggaaaaactactttaatacaa
caactttatgttgagtttaaaatcagaggcttagatgttggagccgcaactgaatatagt
acagaatatcttaaagaaaaaggtatgatagaaactatttctgaacaatacggtatttat
ttaggacaacttcgtttagaagaatcattaaatcaatttgattatgctttaacagattat
gcaacttttgtaccatatatatatggaagatttatgctaggtgataaaaaaagatctgaa
aaagaaattgaaatactaaaagatctttaccatttagctcttaaagatcttcaaaagtat
gatcatatcttctttgttcctagagaatttggttatactcaagatggtgttagatggcaa
gatgaatcaactgcctctgccgttgataatgcattaaagcaattcttagatagtgaaaat
gttaaatacacaactatagaaggttcaactaaagatagagctagacaaatactatctatt
gttggattagataataaagacgcactgcctactatgagagagcttaaaaagaaaaattca
aaataa

DBGET integrated database retrieval system