KEGG   Clostridium perfringens 13: CPE0618Help
Entry
CPE0618           CDS       T00074                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose reductase
  KO
K00067  dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00521  Streptomycin biosynthesis
cpe00523  Polyketide sugar unit biosynthesis
cpe01130  Biosynthesis of antibiotics
Module
cpe_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CPE0618
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CPE0618
Enzymes [BR:cpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     CPE0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RmlD_sub_bind Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 3Beta_HSD NAD_binding_10 DapB_N FERM_N
Motif
Other DBs
NCBI-ProteinID: BAB80324
UniProt: Q8XMS0
Position
774028..774912
Genome map
AA seq 294 aa AA seqDB search
MKILITGSNGQLGNELQSIIKSGKAEIGSVSENIKNSEVIALDVDKLDITSLENVKNVLN
EEKPDVVINCAAATNVDGCESNEDFAFKVNSLGARNLAMVCEEIGAKLVQVSTDYVFSGF
GEKPLTEFDLTAPYSVYGKTKLLGENYVKEFCSKYYIVRTAWLYGYVGHNFVYTMMRLGK
EKESLNVVNDQKGNPTHANDLAYHILKLIETEEYGIYHCTGKGECTWYDFAKEIMELAGN
KCIVNPCTSEEYKTPAKRPEYSSLDNMMLRCTIGDEMRDWKEALKSFFENQQNQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaataacaggttcaaatggacaattaggaaatgaacttcaatcaataata
aaaagtggaaaagcagaaataggttcagttagtgaaaatataaaaaactcagaagttatt
gctttagatgttgataaattagatataactagcttagaaaatgttaaaaatgtacttaat
gaagaaaaaccagatgtagtaataaactgtgcagcggcaacaaatgttgacggatgtgaa
agtaatgaagattttgcatttaaagttaattctttaggagcaagaaatttagctatggtt
tgtgaagaaattggagctaaattagttcaagtttcaacagattatgtatttagtggtttt
ggtgaaaaaccattaactgagtttgatttaactgcaccttatagtgtttatggaaaaaca
aaacttttaggtgaaaattatgttaaagagttttgttcaaaatattatatagttagaacc
gcttggttatatggatatgtgggacataactttgtttacacaatgatgagacttggaaaa
gaaaaagaatcattaaatgtagttaatgatcaaaaaggaaatccaactcacgcaaatgat
ttagcatatcatatattaaagcttatagaaacagaagaatacggaatataccattgtaca
ggaaaaggggaatgtacttggtatgattttgctaaagaaataatggagttagctggcaat
aagtgcattgttaacccatgtacttcagaagaatataaaacaccagctaaaagaccagaa
tattcatcattagataatatgatgcttagatgtacaattggtgatgaaatgagagattgg
aaggaagctttaaaaagcttttttgaaaatcaacaaaatcaataa

DBGET integrated database retrieval system