KEGG   Clostridium perfringens 13: CPE0622Help
Entry
CPE0622           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
778167..778907
Genome map
AA seq 246 aa AA seqDB search
MSKVKRKLKNIVRNIMLSETFANTNLVKNMRKNHKEKLEEGRRVLFKEHAKDCLETIKEN
LDKNNLHFWLDYGTLLGAMREKDFIAHDLDIDLGMFYENQVEEVEKAFKEANIKKVREFT
LDGKVVEQTYSYKGLYFDIFYYFKDENLMWTYGFTFKNNKLNKVSYKDKDVSTGFEGMKY
FVKKRGLEKIMFKGKEYTVPENPDGYLRENYGPNYMTPIKEWDYVEAPTNQEKLKGGDIV
MIEYYN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtgaaaagaaaattaaagaacatagtaagaaatattatgttgagtgaaact
tttgcaaatacaaatttagtaaaaaatatgaggaaaaatcataaagagaaattagaagaa
ggaagaagagttttatttaaagagcatgctaaagattgtttagaaactataaaggaaaat
ttagataagaataatcttcatttttggcttgattatggaactttgcttggagctatgaga
gaaaaggattttatagcacacgatttagatatagatttaggaatgttttacgaaaatcaa
gttgaagaagtagaaaaagcttttaaagaagctaatataaaaaaagttcgtgaatttact
ttagatggtaaggtagtagagcaaacatatagctataaagggttatactttgatatattt
tactattttaaagatgaaaatcttatgtggacatatggatttacttttaaaaataataaa
ctaaataaagttagttataaagataaggatgtatcaactggctttgaaggaatgaagtat
tttgttaagaagagaggccttgaaaaaatcatgtttaaaggaaaagaatatacagttcct
gaaaatccagatggttatttaagagaaaattatggaccaaattatatgacacctataaag
gaatgggattatgtagaagcaccaacaaatcaagaaaagttaaagggtggagacatagta
atgatagaatattataattag

DBGET integrated database retrieval system