KEGG   Clostridium perfringens 13: CPE0629Help
Entry
CPE0629           CDS       T00074                                 

Definition
(GenBank) probable lic-1 operon protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
789373..790056
Genome map
AA seq 227 aa AA seqDB search
MRAILLAAGMGTRLRPLTLDTPKSLIEVNGRPLLERQIEFLRERGVEEIIVVTGYLAEKF
DYLKDKYGVKLVNNDKYDIYNNIYTMYLVREYLENTYVVDADVYISENFLLEKPETSMYF
SANKQGFKGEWKLSFDEDLKVNDIEVGDDEGYILCGVSYWDKKDTDIIVKELEDMVENGD
FSELYWDDIVKNNISKLDIRIEKISENSIYEIDNLEELDYVKSVVEK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatattactagcagcaggaatgggaactagattaagacccctaactttagat
acacctaagtcacttatagaagttaatggaagacctcttttagaaagacagatagaattt
ttaagagaaagaggagtagaagaaataattgtagttacaggttatcttgcagagaaattt
gattatttaaaggataaatacggagtaaaactagttaataatgataaatatgatatatat
aacaatatatatactatgtatttagttagagaatatttagagaatacctatgttgttgat
gctgatgtttatatatcagaaaatttcttattagaaaaaccagaaacatcaatgtatttt
tctgccaataaacaaggttttaaaggagaatggaaacttagctttgatgaggatttaaag
gtaaatgatatagaagttggagatgatgagggctatatattatgtggagtatcttattgg
gataagaaagatacagatataatagttaaggagcttgaagacatggttgaaaatggcgat
tttagtgagttatattgggatgatattgtaaagaataatatttctaagttagatattcgc
attgaaaagatttcagaaaatagtatttatgaaattgataatttagaagaattagactat
gttaaatcagtagtagagaaataa

DBGET integrated database retrieval system