KEGG   Clostridium perfringens 13: CPE0636Help
Entry
CPE0636           CDS       T00074                                 

Definition
(GenBank) probable phosphate ABC transporter
  KO
K02040  
phosphate transport system substrate-binding protein
Organism
cpe  Clostridium perfringens 13
Pathway
ABC transporters
Two-component system
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CPE0636
  Signal transduction
   02020 Two-component system
    CPE0636
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    CPE0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
798746..799576
Genome map
AA seq 276 aa AA seqDB search
MFKKRLIAIIGTIFIGATAMVGCNSGGSEAKSTNSVSISGSTSVGPVMEAEAEAFKTKKP
DVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQAGLKEVEIAYDGIALITHKNNP
VKDLTLAQIKDIYTGKITNWKELGGNDAPIVVVSREDGSGTRDAFQEIVGFKAEELTVNS
QISDGSGNIKSLVQGNENAIGYISFSYVDDSVSAVKVDGVEATPENVLNKSYKVSRPFLA
VYKEENLTESGKSFIDFILSEEGQDIVAKEHLIKVK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaagagattaatagcaattataggtactatatttataggtgcaacagccatg
gttggatgtaattctggaggaagcgaagcaaaatctacaaattcagttagtatatctgga
tcaacttctgtagggccagttatggaagcagaggcagaggcttttaagactaagaaacca
gatgtatctatagaaataaatcaaataggatcatcagcaggcattaaaaatgccatggag
ggagtttcagaaataggaatggcttcccgtgaccttaagggagaagaaaaacaagcagga
cttaaagaagtagaaatagcttatgatggaatagctttaataacacataaaaataatcca
gtgaaggatttaacattagctcagataaaagacatatatacaggaaaaataacaaattgg
aaagaacttggagggaatgatgctccaatagtggttgtttctagagaggatggatctgga
acaagagatgctttccaagaaatagtaggatttaaggctgaagagttaactgttaattct
cagatatcagatggatcaggaaatatcaagtccttagttcaaggtaatgaaaatgcaata
ggatatatatcttttagttatgttgatgatagtgtaagtgcagtaaaggttgatggagtt
gaagcaacaccggaaaatgttttaaataaatcttacaaagtttcaagacctttcttagca
gtatataaggaagaaaatttaacagaatcaggtaagagctttatagatttcatattaagt
gaggaagggcaagacatagtagctaaagaacacttaataaaagtaaaatag

DBGET integrated database retrieval system