KEGG   Clostridium perfringens 13: CPE0639Help
Entry
CPE0639           CDS       T00074                                 

Definition
(GenBank) probable phosphate ABC transporter
  KO
K02038  
phosphate transport system permease protein
Organism
cpe  Clostridium perfringens 13
Pathway
ABC transporters
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CPE0639
Transporters [BR:cpe02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    CPE0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
801590..802414
Genome map
AA seq 274 aa AA seqDB search
MRKVKDNILNGLVWLSAIFTIGILVIILGFIFVKGIGKINLTFLTSNYSAGGGGGILPMI
VTTLWTVLLSLAVATPIGVLGAVYLQEYAKQGKMVKFIRFATESLAGIPSIVYGLFGGIF
FVVALKMGYSILAGSLTVSIIILPVIIRTTEEALKTVPESYREASLGLGATKFQTLYKVI
LPSAMPGILSGVILSIGRIIGESAAILLTAGTVAQMPKGIFSSARTLTVQAYLVTKEKGD
IETAAAVGIVLIVIILALNISAKLIAKKFNKANY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagttaaagataatatattaaatgggttagtttggttatcagccatatttaca
ataggaattcttgtaattattttaggattcatatttgtaaagggcataggaaaaataaat
ttaacattcttaacaagtaattattcagctggtggcggtggtggaatattgccaatgata
gtaacaactttatggactgttttactttccttagcagtggctactcccataggagttttg
ggagctgtatatttacaagaatatgctaaacaaggaaagatggttaagtttataagattt
gctactgaaagtttagcaggtattccttcaatcgtttatggattatttggaggtatattc
tttgtagtagctttaaaaatggggtattcaattttagcaggttcattaacagtatcaata
ataatcttacctgtaataattagaacaacagaagaggcattaaaaactgtgccggaatca
tatagagaagcatccttaggattaggtgctacaaagtttcaaactttatataaagtaata
ttaccaagtgcaatgcctggaatactttcaggagtaatattatcaataggacgtataata
ggggaatcagcagctatattacttactgctggaactgttgcacaaatgccaaaaggaatt
ttttcaagtgcaagaacacttacagttcaagcttaccttgtaacaaaggaaaaaggagat
atagaaacagcagcggcagttggaatagttcttatagttataatactagcattaaatatt
tcagctaagttaatagctaaaaaatttaataaggcaaactattaa

DBGET integrated database retrieval system