KEGG   Clostridium perfringens 13: CPE0642Help
Entry
CPE0642           CDS       T00074                                 

Definition
(GenBank) two-component response regulator
  KO
K07658  
two-component system, OmpR family, alkaline phosphatase synthesis response regulator PhoP
Organism
cpe  Clostridium perfringens 13
Pathway
Two-component system
Module
PhoR-PhoB (phosphate starvation response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CPE0642
Two-component system [BR:cpe02022]
 OmpR family
  PhoR-PhoB (phosphate) [MD:M00434]
   CPE0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
804031..804726
Genome map
AA seq 231 aa AA seqDB search
MTNKKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKVIREIKFDLILLDLMLPEI
DGLEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKAL
LRRSNVKKEENIIKFGDVVVNFKTREVTKGTQNVELTLKEFELLKLLIKNKGNILTRELL
LDKIWGYEYIGETRTVDVHIRHLRKKIESDDKNPQYIQTIRGVGYKFTSNE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaaaaagtcctaatagtagatgatgaggaacatattagagaacttataaaa
tttaatttaaaaaaagagggatatgatacagaggttgctgttaatggaactgaagctcta
aaggttataagagaaattaagtttgatttaatacttttagatttaatgcttccagaaata
gatggcttagaagtatgtaaagaaattagaagaaatgaagaaacttcagatattccagta
atgatgattacagcaaagggggaagagtttgataaagtattaggcttagaacttggagca
gatgattatataacaaagccattttcaataagagaacttatggctagagtaaaagcttta
ctcagaagaagtaatgttaaaaaagaagaaaatataattaaatttggtgatgtagtagtt
aattttaaaacaagagaagtaacaaaaggaactcaaaatgtagaattaacattaaaagag
tttgaattattaaagcttcttataaagaataagggcaatatattaactagagaacttttg
cttgataaaatttggggatatgaatacataggtgaaacaagaacagtagatgttcatatt
agacatttacgtaaaaagattgaaagcgatgataaaaatcctcaatatattcaaactata
agaggcgttgggtataagtttacaagtaatgagtaa

DBGET integrated database retrieval system