KEGG   Clostridium perfringens 13: CPE0647Help
Entry
CPE0647           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(808605..809693)
Genome map
AA seq 362 aa AA seqDB search
MSLGKLTARHFIFFIIAAISTSLVNYTSLFIKIGGRDTWIFTIISGIIFFFVTSFIFSVI
SKIEYYDFKETCYIVLGKPLGNIYILIFSLTLVLMCIESASVSSSSINVNIFAQSPIWYC
LLFFIITVFLIGKNRFNSILIICIVCVSIVLAINLLLALLNIRYIDYTLLLPIFKDRRIS
EYILCALTQLGSLSSLAIVLPILPRIDDKKNLKKISINTILLTSIFCALCVVILISTLGS
LRSANVFYPQFVQTQRIYFGGFVENGNVFVMISSTLSWVVKYLITIFSLYTIWKDRVKYK
RNFIALISVIVYAFSYLAAKNAYTLFILLRYYQYILLIVLFICPIIIYTLAYFKRQKFKY
LK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgggaaagctaactgcaagacattttatattttttatcattgctgccataagt
acatctttggttaactatacatccttatttataaaaataggtggaagagatacttggatt
ttcactataatctctggaattatatttttctttgtaacttcctttatttttagtgtaatc
tcaaagatagaatattatgactttaaagaaacttgctatatagttcttggtaaaccctta
ggaaatatttatatattaatattttcacttactttagtcttaatgtgcatagaatcagct
tctgtaagctcatcttctataaacgttaatatttttgctcaaagtccaatatggtattgt
ttattgtttttcataataactgtatttttaataggtaaaaatagatttaatagcatactt
ataatatgtatagtttgcgtaagcattgtacttgcaattaatttattattagcattatta
aacattagatatatagattacacacttcttcttcctatatttaaggatagaagaatttca
gaatatattctttgtgctttaactcaattaggctccttatcaagcttagctatagtttta
cctattcttccaagaatagatgataagaaaaacttaaaaaaaatctcaataaacacaata
cttttaacatctatattttgtgctttgtgtgttgttatactaatatcaaccctaggttct
ttgaggtctgcaaatgttttttatcctcaatttgttcaaactcaaagaatttattttggt
ggttttgtagagaatggaaatgtttttgtaatgatttcttctactctttcttgggttgta
aaatatttaataactattttttcattgtatacaatttggaaagatagggtaaaatataaa
cgtaattttatagcattaatttcagtaatagtatatgccttttcttacttagctgctaag
aatgcctataccctttttatactattaagatactatcaatacatacttctaatagtgctg
tttatatgccctataatcatatatacactagcttattttaagcgtcagaaatttaaatat
ttgaagtaa

DBGET integrated database retrieval system