KEGG   Clostridium perfringens 13: CPE0651Help
Entry
CPE0651           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
813713..814126
Genome map
AA seq 137 aa AA seqDB search
MIQLFFNQRGAGKSKNLVKLANEEIEKSKGSIIFIDNDNKRMLQLNKKVRLIPMDNYCVK
SYDQFYGFLQGIISRDYDVESIYIDSIANILDDIKLEDLENYLKKIELMSRELNVNVFVT
IHGDVKIMPENIKKYVA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgattcaattattctttaaccaaagaggcgctggaaagagcaaaaatttagttaaacta
gctaatgaagaaattgaaaagtctaaaggaagtattatttttattgataatgataataaa
agaatgcttcagttaaataaaaaggttagacttatacctatggacaattattgtgtaaag
agttatgatcaattttatggatttttacaagggataatttctagagattatgatgtagaa
agtatatatattgatagcatagcaaatattttggatgatataaaattagaggatttagaa
aattatttgaaaaaaatagaacttatgagcagagaacttaatgtaaacgtatttgtaact
attcatggagatgtgaaaataatgcctgaaaatatcaagaaatatgtggcttaa

DBGET integrated database retrieval system