KEGG   Clostridium perfringens 13: CPE0657Help
Entry
CPE0657           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
819969..821306
Genome map
AA seq 445 aa AA seqDB search
MDFERTRRKLLNIAMEAEEENKSLTDDFKREFWSLIEKVIISLYDKENSFFGQFLIHVKR
EIRTDIKWPIATKPEMGYFTMVFNPSIILECDLKEVQALLKHEVYHIMMSHYAREKALSR
KYSKLAVSIAMDIAINQYIKNLPPYSKRLDYVNLEYNLELKPDMPMEKYAEEIQKAIERR
KKYGITGDDKNAGDLVSQEKSHEVWEEVSISLDSLEGTTKKTAINAYKGKAPKDLEKIIL
LMKEKPEIKWSEFLKDIIPTTRGSYRKTITRKDRRLPERLDLRGKLPNSIPKILIAIDVS
ASISDKEFENIIIEVLGIVRNKNAEIKVIECDDEIRRVYDLKGIKDIKPRSKKNGSTRFS
PVFRYIKENNMRNHILVYFTDGVGEKDLEVKPINYRTLWVLTGKEQLSLNKSFGTVKHLE
KEKGDGYTLMDGLQDMKDNLHDWAR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaagaactaggaggaaacttcttaatatagcaatggaagctgaagaagag
aataagtctttaacagatgattttaagagagaattttggagcttaatagagaaggtaata
atctctctttatgataaagaaaattcattttttggtcagtttttaattcatgtaaagaga
gaaataagaactgatattaaatggcctatagccactaaaccagaaatgggatatttcaca
atggtatttaatccaagcataatattagaatgtgatttaaaagaggttcaggccctttta
aagcatgaagtatatcatataatgatgtctcattatgctagagaaaaggctttaagtaga
aaatattcaaaacttgctgttagtatagctatggatatcgccataaatcagtatataaag
aatttacctccatatagtaaaaggctagattatgtgaatttagaatataatctagaatta
aaaccagatatgcctatggaaaaatatgcagaagaaattcaaaaagcaattgaaagaaga
aaaaaatatggtattactggtgatgataaaaatgctggtgatttagtaagccaagaaaaa
tcccatgaagtatgggaagaggtttctataagcttagatagtttagagggaacaactaag
aaaacagccataaatgcatataagggaaaggctcctaaggatttagaaaaaataatctta
ctaatgaaagaaaaaccagagataaagtggagtgaatttttaaaggatataattcctaca
acaagaggaagttatagaaaaactataacaagaaaagatagacgtcttccagaaagatta
gaccttagaggaaaattgccaaattctattccgaaaatattaatagcaatagatgtttca
gcatccatttctgataaagagtttgaaaatataataatagaagttttaggtatagtaaga
aataaaaatgctgaaataaaagttattgaatgtgatgatgaaataagaagagtttatgat
ttaaaaggaataaaagatataaagccaagaagtaagaaaaatggctcaacaagattttct
ccagtatttagatatataaaagaaaataatatgagaaatcatattcttgtatattttaca
gatggagttggagaaaaagatttagaggttaagcctataaattatagaactctttgggtc
ttaacaggcaaggaacaattaagtttaaataaatcttttggaactgttaaacatttagaa
aaagaaaaaggggatggatatacccttatggatggtttgcaagatatgaaggataatctt
catgattgggctagataa

DBGET integrated database retrieval system