KEGG   Clostridium perfringens 13: CPE0660Help
Entry
CPE0660           CDS       T00074                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
824764..825528
Genome map
AA seq 254 aa AA seqDB search
MVIFFQGCNFKCLYCHNPETINKCTSCGKCVENCEVGALSISEGKVIWDEEECISCDKCI
KLCEHMSSPKLKEYSVEELVKKIEKDSFFIRGITVSGGECTLNSEFLIKLFREVKKLGLT
CFVDTNGNTKLDDELINLTDKFMLDVKSIDEKENIWLTKSSNKLVLENLKKLLELDKMYE
VRTVIAKGLNSEKTVDEVSKIIGDKCRYKLIKYRPFGVREEGIKVHGTISPEDSYMNELK
EKSIANGCIDTIIT
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggttatattttttcaaggatgtaattttaagtgtttgtattgccacaatcctgaaact
ataaataaatgcacctcttgtggaaaatgcgttgaaaattgtgaagtaggtgccttatca
attagtgaggggaaagttatttgggatgaggaagaatgtatttcttgtgataaatgtata
aagctatgcgagcatatgtcttctcctaaacttaaggaatattcagtagaagagcttgta
aaaaagatagaaaaagatagtttttttataagaggaataactgttagtggtggagaatgc
actttaaactctgaatttttaataaaactttttagagaagttaaaaaacttggattgact
tgctttgttgatactaatggtaatactaaattagatgatgaacttataaatcttacagat
aagtttatgcttgatgttaagtcaattgatgaaaaagaaaatatttggctaactaaatca
tcaaataaattagttttagaaaatttaaaaaaattattagagttagacaagatgtatgaa
gttagaactgttatagctaaaggactaaatagcgaaaaaacagtggatgaagtatctaaa
atcattggtgataaatgtagatataaacttataaaatatagaccctttggagttagagaa
gaggggataaaggttcatggaactataagcccagaagatagctatatgaatgaattaaaa
gaaaaatctatagctaatggatgtattgatacaataataacttaa

DBGET integrated database retrieval system