KEGG   Clostridium perfringens 13: CPE0661Help
Entry
CPE0661           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
825828..826343
Genome map
AA seq 171 aa AA seqDB search
MKKFFIMVLSIIVIVGGVLFYRFKTRKFLNFNLESISIEQATESDFRNSPSKDNKNEEPL
DYFDIVFSIRAKNTSKNLCTDNIVPHIILPKELKSNGYIDIGLNPLSSTDEIILPGHEKG
FPYKLFVKKGKYLKEELLKFLRECKFKVNIVSFKKTKLQFLTYGGSVDYIE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattttttataatggtactttctataatagttatagtaggaggagtattattt
tatagatttaaaacaagaaagtttttaaactttaatttagagagtatttctatagagcaa
gctactgaaagtgattttagaaatagcccatcaaaagataataaaaatgaagagccttta
gattattttgatatagtttttagtattagagctaaaaatacatctaaaaatttatgcaca
gacaatatagtaccacatattatattgcctaaagaattaaagtcaaatggttatattgat
attggattaaatcctttaagtagtacagatgagataatattaccaggtcatgaaaaggga
tttccttataaactttttgtgaaaaagggaaaatatttaaaagaagagcttttaaaattt
ttaagagagtgtaagtttaaagttaatatagttagctttaaaaaaactaaactacagttt
ttaacctatggaggaagtgtagattatattgaataa

DBGET integrated database retrieval system