KEGG   Clostridium perfringens 13: CPE0665Help
Entry
CPE0665           CDS       T00074                                 

Definition
(GenBank) hypothetical protein
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
830406..831137
Genome map
AA seq 243 aa AA seqDB search
MVPYNIDYCEEKIKEYKNKIKENKKGDFIIRYSEGKEFNGYLYEHKQSLKESPIELYEGE
KLWMRISPHEIQGAFEGIKRAKGKVGVLGLGLGYFVQEIAKSDQVREIVVYEMSEEIIDL
YLENFGENPKIRIVKGDGFKAKRENFDFFYVDIYEYKLTTKVVEDYVKLTKLHDIVEYSF
FGVESFILSCPTSEIIWVYILEEWMDMSKDLFTRFNHSEYIEYFSPMEENMVLEVLEEFG
KIL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggtaccatataacatagattattgtgaagaaaaaataaaagaatataaaaataaaata
aaagagaataaaaaaggtgatttcattattagatatagtgagggaaaagaatttaatggc
tatttatatgaacataagcagtcattaaaagaaagtcctatagaactatatgaaggagaa
aagctttggatgagaatttcaccgcatgagattcaaggagcttttgaagggataaaaaga
gcaaaaggtaaggttggggttctaggattaggattaggatactttgttcaggaaatagca
aaaagtgatcaagtaagagaaatagttgtctatgaaatgagtgaagaaataattgactta
tacttagaaaactttggagaaaatcctaagataagaatagtaaaaggagatgggtttaaa
gctaagagagaaaactttgactttttctatgtggatatatatgaatataaattaactact
aaagttgttgaagactatgttaaattaacaaaacttcatgatattgtagaatatagcttt
tttggagtagagtcctttatattaagttgtccaactagtgaaataatatgggtttatata
ttagaagagtggatggatatgtcaaaggacttatttacaagatttaatcacagtgagtat
attgaatatttttcacctatggaggagaatatggtattagaggtacttgaagaatttggg
aaaattctttaa

DBGET integrated database retrieval system