KEGG   Clostridium perfringens 13: CPE0666Help
Entry
CPE0666           CDS       T00074                                 

Definition
(GenBank) probable transposase
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
831185..831457
Genome map
AA seq 90 aa AA seqDB search
MATTYAKSINCLTLANKLYFCLKYLTYVKLNNNIIKALKGVSARLLFLKHPEIKRYLCGG
NLWNPSYFVATVSENTEEQIRNYIQNQQVK
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
attgccacgacatatgctaaaagcataaactgtctaacacttgcaaataagttatatttt
tgtttaaaatatttgacatatgttaagttaaataataatataattaaagcgttaaaggga
gtatctgcaaggttactgttcttgaaacatcctgaaattaaaagatatctatgtggagga
aacctatggaatccaagctattttgtagctactgtatcagagaatacagaagaacaaatt
agaaactatattcaaaatcaacaagtaaagtga

DBGET integrated database retrieval system