KEGG   Clostridium perfringens 13: CPE0667Help
Entry
CPE0667           CDS       T00074                                 

Definition
(GenBank) probable transposase
Organism
cpe  Clostridium perfringens 13
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
831468..831821
Genome map
AA seq 117 aa AA seqDB search
MIRKKAYKFRIYPTKKQAELINKTIGCCRFVFNYSLGVQKTKDNYWNIVEEMVQQGYFQE
NNWKGEFFNKANSIKDIAKLKKSYDWLKEVDSIALQASVENLGAGYDKYYKKNRWQT
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgataagaaagaaagcatataaatttagaatatatccaactaagaaacaagccgagcta
attaacaagactattggatgttgtaggtttgtattcaactattctttaggtgttcaaaaa
actaaagataattattggaatatagttgaggagatggttcaacaaggctacttccaagag
aataattggaaaggcgagttctttaataaagccaattcaattaaagatatagctaaatta
aagaaaagctatgattggcttaaagaagtagatagcatagcactacaggcttctgttgaa
aatcttggtgctggatatgataagtattacaaaaaaaacaggtggcagacctaa

DBGET integrated database retrieval system