KEGG   Clostridium perfringens 13: CPE0670Help
Entry
CPE0670           CDS       T00074                                 

Definition
(GenBank) leucine-tRNA ligase
  KO
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
cpe  Clostridium perfringens 13
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPE0670
Enzymes [BR:cpe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     CPE0670
Amino acid related enzymes [BR:cpe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CPE0670
Transfer RNA biogenesis [BR:cpe03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CPE0670
 Prokaryotic Type
    CPE0670
Mitochondrial biogenesis [BR:cpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CPE0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(834018..836468)
Genome map
AA seq 816 aa AA seqDB search
MGNYSTAIDKKWQDKWAESGLYKFDPNKEGEKLYVLEMFSYPSGSQLHAGHWFNYGPVDS
WARFKRMQGYNVFQPMGFDAFGLPAENFAIKTGIHPQDSTIKNIAKMEEQLKAMGAMFNW
ENEVVTCSPEYYKWTQWLFLKLYEKGLAYRKKAPVNWCPSCQTVLANEQVVDGACERCST
EVTKKDLTQWFFKITDYADELLDKLDGLDWPEKTVSMQKHWIGRSTGSQVNFKVKDSDLN
FDVFTTRVDTLCGVSYVVLAPENPLVDEIVSAEQKEAVENYKEEAKKQSDIERQSISREK
TGVFTGAYAIHPLTGKEVPIWVGDYVLATYGTGAVMAVPAHDERDFAFAEKFNLPINRVI
EAKDGSETNLPFCEHGILVNSGEFDGLTTDEAKEKIVEKLSSMGLGEKKVNFRLRDWLVS
RQRYWGAPIPVVYCEECGIVPVPESQLPVELPYDVEFAPDGKSPLAKSEAFVNTTCPHCG
KPAKRETDTLDTFVCSSWYYLRYPDNKNTEAPFNPELINKMLPVDKYVGGPEHACMHLLY
ARFITKALRDMGYLNFDEPFTSLTHQGLILGPDGLKMSKSKGNTISPDDYIKEYGADVFR
MYLMFGFAYTEGGAWSDDGIKSVNRFVERIERIIDTAREAISKGENNKTTMDKAEKELNY
WRHNTIKSVTDDTDKLQFNTAIARMMEFINALSKYTQEKEMNLDFLKDVVSDYLRLLAPF
APHFSEEQWNLLGNSYSIFNEAWPKFDPKALVKDEVEIAIQVNGKIKNKIMVSSDLDEEG
IKAAALADEKIIASTEGKTVVKVIVIKGRLVNIVVK
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactatagtactgccatagataagaaatggcaagacaaatgggctgaatcaggc
ctttataaatttgatccaaataaagaaggagagaaactttacgttttagaaatgttctca
tacccttcaggtagccaattacatgcaggtcactggtttaactatggaccagttgattca
tgggctagatttaaaagaatgcaaggatataatgtattccaaccaatgggatttgatgct
ttcggtttacctgctgaaaactttgctataaaaacaggaatacatcctcaagattctaca
ataaaaaatatagctaaaatggaagaacaattaaaagctatgggagctatgtttaactgg
gaaaacgaagttgtaacttgctcacctgaatattataaatggactcaatggctattccta
aaattatacgagaaaggattagcttatagaaaaaaagctcctgtaaactggtgtccatca
tgccaaacagttcttgctaacgagcaagtagttgatggagcttgtgaaagatgttcaaca
gaagttactaaaaaagatcttactcaatggttctttaaaataactgattatgctgatgaa
ttattagataaattagatggtttagattggccagaaaaaacagtttctatgcaaaaacac
tggataggaagatcaactggttctcaagttaactttaaagttaaagatagcgatttaaac
tttgatgtattcacaacaagagttgatactttatgcggagttagctatgttgttttagct
cctgaaaatccattagtagacgaaatagtttcagctgaacaaaaagaagctgttgaaaat
tataaagaagaagctaaaaaacaatctgatatagaaagacaatctatttcaagagaaaaa
actggtgtattcactggtgcatatgctattcatccattaacaggcaaagaagttcctata
tgggttggagactacgttctagcaacttacggaactggagctgttatggctgttcctgct
catgatgaaagagattttgcttttgctgaaaaattcaaccttccaataaatagagttata
gaagctaaagatggtagtgaaactaaccttccattctgcgagcacggtatattagttaac
tcaggtgaatttgatggattaactacagatgaggctaaagaaaaaatagttgaaaaacta
tcttcaatgggtcttggagaaaaaaaagttaactttagattaagagactggttagtttca
agacaaagatactggggagctccaattcctgtagtttactgtgaagaatgtggtatagtt
cctgtacctgaaagtcaattaccagttgaattaccatatgatgttgaatttgctccagat
ggaaaatctccactagctaagagcgaagcatttgttaacacaacttgccctcactgtgga
aaaccagctaagagagaaactgatactttagatactttcgtatgttcatcatggtattac
ttaagatatcctgataataaaaatactgaggctccatttaatcctgaattaatcaacaaa
atgttaccagttgataaatacgttggtggccctgaacatgcttgtatgcatcttctttac
gcaagattcataactaaagccctaagagatatgggatacctaaactttgatgaaccattt
acttcattaactcaccaaggattaatcttaggaccagacggattaaaaatgagtaaatca
aaaggaaacacaatatctcctgatgattatataaaagaatatggtgcagatgtatttaga
atgtacctaatgtttggttttgcttacactgaaggtggagcttggagtgatgatggaatc
aaatctgtaaatagattcgttgaaagaattgaaagaattatagatactgctagagaagca
atctcaaaaggtgaaaataataaaactacaatggataaggctgaaaaagagcttaactat
tggagacataatactataaaatctgttacagatgatacagataaacttcaatttaataca
gcaatagctagaatgatggaattcataaatgctctatctaaatatactcaagagaaagaa
atgaatcttgatttcttaaaagatgtagtttctgattatttaagattattagcaccattt
gcacctcacttcagtgaagaacaatggaacttacttggaaattcatactcaatcttcaat
gaagcatggccaaaatttgaccctaaagctttagttaaagacgaagttgaaatagctatc
caagttaacggaaaaatcaaaaacaaaataatggtttcttctgatttagatgaagaagga
ataaaagccgctgctttagctgatgagaaaatcatagcttcaacagaaggaaaaacagtt
gtaaaagtaatagttataaaaggtagacttgtaaatatagttgttaaataa

DBGET integrated database retrieval system