KEGG   Clostridium perfringens 13: CPE0944Help
Entry
CPE0944           CDS       T00074                                 

Gene name
pldB
Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
cpe  Clostridium perfringens 13
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CPE0944 (pldB)
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CPE0944 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1141575..1142564
Genome map
AA seq 329 aa AA seqDB search
MCKTLNRKYIYKYGEKKEDVEIVENMLNRMRNSGTFKGENFANIYYEKYIVEESDKAIVI
CHGFSECIEKYHEIIYYFLNEGFSVYIMEHRGHGRSGCLSKSCNTQVEVESFDYYVKDLK
TFLNEVVLKDKRFNNNLYLFAHSMGGAIGTIFLENNHGYFKKVILNSPMFRINTREYSHI
KCKLIAKFLILMGKGENFIFGQKPFEEEENLEASGTSDKLRHGLYHKFLLENPILRRGGG
SIHWYKEAARATDCLMKKRNIERIDTPILLFKSEFDSYVDTKFHDEFKKVAKYCELIEVK
GSKHEGFFEKDEILYDYLDKIFKFLEENN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaactttaaatagaaaatatatttataaatatggggagaaaaaagaggatgta
gaaatagttgaaaatatgctaaataggatgagaaatagtggaacttttaaaggagagaat
tttgctaatatatattatgaaaaatacatagtggaagaatcggataaagcaatagttata
tgtcatgggttttcggaatgtatagagaagtatcatgaaataatatactattttctaaat
gaaggtttttcagtttatataatggaacatagaggtcatgggagatcaggctgtttaagt
aaatcttgtaatacacaggtggaagtagaatcctttgattactatgttaaagatctaaag
acatttttaaatgaggttgtattaaaagataagaggtttaataataatttatatttattt
gcacattctatggggggagctataggtactatatttttagaaaataatcatgggtatttt
aagaaggtaattttaaattctccaatgtttagaataaatacaagagaatactctcatata
aaatgcaaattaatagctaaatttttaattcttatgggaaaaggagagaattttattttt
ggacaaaaaccctttgaggaagaggagaatttagaggcatcaggaacatcagataaactt
agacatggcttataccataaatttctcctagaaaatcctattttgagaagaggtggaggc
tctattcattggtataaagaagctgcaagggcaactgattgtttaatgaaaaagagaaat
atagagagaattgacacgcctattttattatttaaaagtgagtttgattcctatgttgac
acaaaatttcatgatgagtttaaaaaggtagctaagtattgtgagcttattgaagttaag
ggaagtaaacatgagggattttttgaaaaagatgaaattctttatgattatttagataag
atatttaaatttttagaggaaaataattag

DBGET integrated database retrieval system