KEGG   Clostridium perfringens 13: CPE1185Help
Entry
CPE1185           CDS       T00074                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpe  Clostridium perfringens 13
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPE1185 (pfk)
   01230 Biosynthesis of amino acids
    CPE1185 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPE1185 (pfk)
   00030 Pentose phosphate pathway
    CPE1185 (pfk)
   00051 Fructose and mannose metabolism
    CPE1185 (pfk)
   00052 Galactose metabolism
    CPE1185 (pfk)
  Energy metabolism
   00680 Methane metabolism
    CPE1185 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPE1185 (pfk)
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPE1185 (pfk)
Protein phosphatases and associated proteins [BR:cpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPE1185 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1380727..1381827)
Genome map
AA seq 366 aa AA seqDB search
MMQPIKKIAILTGGGDCPGLNAVIRAVTRTAILKYGYEVIGYKFGYRGLYNNDFVKLDLD
SVSGILHRGGTILHSSNKDNLFDYQVEDENGKIVKKDVSDVGVENLKKEGVDALVVIGGD
GTLTSARDFSRKGVNVIGVPKTIDNDLLATDVTFGFNTATEIATEALDRLHTTAESHHRI
MLLEVMGRNAGWIALESGIAGSADVILLPEIPYDINKIVEKVKEREEAGKQFTIIVVAEG
AKPKDGEVVVSKIVDDSPDPIRLGGIANKLAIDLEGLIKNHEIRSTVLGHIQRGGNTSTY
DRILSTKYGVKAVELINSNLFGNMVALKGNKVSYESLENVIGHTKNVDPEGELVNTAKSI
GISFAD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaccaattaagaaaatagctatactaacaggaggaggagattgtcctggatta
aatgcagtaataagagctgtaactagaactgcaatcttaaaatatggatatgaagttata
ggttataaatttggatatagaggtctatataataatgactttgtaaaattggatcttgat
tctgtttctggaatacttcatagaggaggaacaatacttcatagttcaaataaggacaac
ctatttgattatcaagttgaagatgagaatggtaaaatagttaaaaaagatgtttctgat
gttggtgttgaaaacttaaagaaagaaggggtagatgctctagttgttattggaggagat
ggaaccttaacctctgcaagagatttctcaagaaaaggtgtaaatgtaataggtgttcct
aaaacaatagataacgatttattagccacagatgtaacctttggatttaatactgccaca
gaaatagctacagaagctttagatagacttcatactacagctgagtcacatcatagaata
atgcttttagaagttatgggaagaaacgctggttggattgctttagaatcaggaatagct
ggttctgctgatgtaatattattacctgaaataccttacgatataaacaagatagttgaa
aaagtaaaagaaagagaagaagccggaaaacagtttacaattattgtagttgcagaagga
gcaaaacctaaagatggagaagtagttgtttctaaaatagttgatgatagtccagaccca
ataagattaggaggaatagctaacaaattagctattgacttagaaggattaataaaaaat
catgaaataagaagcactgttcttggacatatacaaagagggggaaatacctctacttat
gatagaatactttccactaaatatggagttaaagctgttgaacttataaatagtaattta
tttggaaacatggttgcattaaaaggaaataaagtatcctatgaaagcttagaaaatgta
attggacatactaaaaatgtagatccagaaggtgaattagtaaacactgctaaaagcata
ggaattagtttcgctgattaa

DBGET integrated database retrieval system