KEGG   Clostridium perfringens 13: CPE1211Help
Entry
CPE1211           CDS       T00074                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cpe  Clostridium perfringens 13
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cpe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(1416350..1417747)
Genome map
AA seq 465 aa AA seqDB search
MNLISSKIDEMKDDLIESVQNIIRIKSVEDEPKEGMPFGEGVSKSLECALEISKKLGFKV
VNLDGHVGYAEYGDGEEYVAALGHLDVVPEGDDWIYPAYGAEIHDGKIYGRGTTDDKGPI
MASLYGLKAIKELGLSLSKKIRIIFGTNEETGSKDIEYYLEHEKAPVAGFTPDAEFPIIN
GEKGITIFDIVKTFEEKTTDGDVLVESIKGGIASNVVASLCETKLKAKEVNKVCEEISKF
AKENNIKFEVSHKNDEIELKVFGVSAHGSTPEKGINAIMQTIKILAELNLAQEDIKAFIK
FLNDNIGEDVYGEKFGILLQDEVSGKLSFNVGVIDLNDKVGRLTLNLRYPVTKTLDDMMT
PFNERIKGTGIEIENFEHQKPLYFSPDHPLIKTLKNVYKEETGKEGELMSIGGGTYAKEM
PNIVAFGPIFPGEPDVIHKPNEYIKIDDLILISKIYAKALYELAK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaataagtagcaaaattgatgaaatgaaagatgatttaattgagtcagtacaa
aatattattagaatcaaaagtgttgaggatgaaccaaaagagggtatgccttttggtgaa
ggagtttctaaatctttagaatgcgccttagaaatttcaaaaaaattagggtttaaagta
gttaatttagatggacatgtaggatatgctgaatatggtgatggagaagaatatgtagca
gctttaggacacttagacgttgttccagaaggtgatgattggatttacccagcatatggt
gcagaaatacatgatggaaaaatatatggaagaggtacaactgatgacaaaggtccaata
atggcatcattatatggattaaaagctataaaagaattaggattatctttatcaaagaaa
ataagaataatatttggtactaatgaagaaactggaagcaaggatatagaatactattta
gaacatgaaaaggctccagtagcaggatttactcctgacgcagaattccctataataaat
ggagaaaagggtatcactatttttgacattgttaaaacttttgaagaaaaaacaactgat
ggagatgtattagttgagagtataaagggtggaatagcatcaaatgtagttgctagtctt
tgtgaaacaaaattaaaagctaaggaagtaaataaggtttgtgaagaaatatcaaaattt
gctaaagaaaataatataaaatttgaagtatcacataaaaatgatgaaatagagttaaaa
gtatttggtgtatcagctcatggtagtactccagaaaagggtataaacgctataatgcaa
actattaaaattttagcagaattaaatttagcacaagaagatataaaagctttcattaaa
ttcctaaatgataacataggtgaagatgtctatggagaaaaattcggaatcttattacaa
gatgaagtatcaggaaaattaagctttaatgttggagtaattgatttaaatgataaagta
ggaagacttactttaaacttaagatatcctgtaactaagactttagatgatatgatgact
cctttcaatgaaagaataaaaggtactggtatagaaatagaaaactttgaacatcaaaaa
ccattatatttctctccagatcatcctttaataaagactttaaagaatgtatataaagag
gaaacaggaaaagaaggagaattaatgtctattggaggaggtacatatgctaaggaaatg
cctaacatagtagcatttggaccaatattccctggagaaccagatgtaattcataaacca
aatgaatacattaaaatagatgacttaattttaataagcaaaatatatgcaaaagcttta
tatgaattagctaaataa

DBGET integrated database retrieval system