KEGG   Clostridium perfringens 13: CPE1266Help
Entry
CPE1266           CDS       T00074                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00052  Galactose metabolism
cpe00511  Other glycan degradation
cpe00600  Sphingolipid metabolism
cpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CPE1266
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPE1266
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPE1266
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CPE1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 Big_4 BetaGal_dom4_5 Dockerin_1 Invasin_D3 EF-hand_7
Motif
Other DBs
NCBI-ProteinID: BAB80972
UniProt: Q8XKX6
Position
complement(1482112..1486179)
Genome map
AA seq 1355 aa AA seqDB search
MQSFNKRGTALGAAIAFALTLAPTLVMAETRQIPESETVNVGFIKDGERSTIFNQNWKFF
KGDPSGAEGVDFDDSSWRGLNLPHDWSIEGDFTVEGEAESGFLLGGTGWYRKAFVVPEKY
NSKDFTLNFDGVYMNAEVYVNGKKVGEHNYGYTSFAFDITEALICDGQTENIIAVKVSNP
VPTSRWYSGSGIYRDVTLSVTDSIHVAHSGTTVTTPKLEEQKGGDVDVAIETIVENESKD
NSMVTVKSTVVNSKGEEVSEAVINEQSIGVNESYTFKQTAIVNNPDLWSVDNPNMYKVKS
EVLLDGKVIDTYFTDFGFRYYNFDKDTGFSLNGENMKLKGVCMHHDQGALGAASYYRAVE
RQMEKMKEMGVNAIRVSHNPASEMLLEICNRLGLLVINEAFDTWTNPKNGNVNDFSKYFN
EVIGEDNEILNGSPEMTWGEFEARSMVKNSKNNPSIIMWSIGNEVLEGISGSASNYTNVA
QNIIDWIKDEDETRHVTIGDNRTKNGDRTAEAISEVVDDNGGLVGFNYANETQVAQQRAN
HPDWTLYASETSSAIHTRGYYKTKGIDYGNHRISEYDNNQTKVGWGHSASDAWKFVIKND
YNAGELVWTGFDYIGEPTPWNGTGTGTVGGGNGAAPKSSYFGIVDTAGFEKDIYYLYQSQ
WNDDVNTLHVLPTWNREDIVIENGNVEVNVFTDAHKVELYLNDKKVGEQTSTEHTTDAGY
KYYTFGNDSLYPVFNVPYEEGTLTAKAYDKEGNEITNTEGRNTVKTTGEASTVRLSADRD
TIDSDGYDLSYITVDIVDEDGNIVQNADNRLNFQLEGDGKIVGVDNGDQTDTDSYKPTSD
TEASRKALSGKALVIVQSTKDAGNIRLNVSGEGLQSQSIEINTVNNAGEDKFLESYEIVK
DYYVNLNEKPELPSTVEGRYSDGTTETFNISWNDYDESQLNTPQVFKINGKLEGTDVAVN
VNVHVIGDVVSMENYSTFTYAGQTPTLPKTVKGYLADGNESEEFKVDWNLEGVDFSEPNT
TVEVLGEVSLLGKTYTVTSTVRVVEALKAAANLAINNSSNKDVPALSQSCVSTADNLNSI
NNGITNNSSNTGERWTNWNERNLTENGEPKGAYVQLDWKNKYNIDRLDLWLFTDNIYGRI
PKKVEISYKNEAGEYEVVTHSNTTEVSYLAGETTYFLDKVINTDSIRVYMQQPEVGKCIG
LSEVAVYEYVPQVSANEGNKLSEIKLDGEALEGFNPDTNEYTVNLKELPKTVEASGEENV
AITILPVHNNKSIIIARSESGAKNIYTVNYVLEESEGSADINEDGSINVGDLSIVSKYQG
EVISGNALSEKSDINKDGVVDKADIQIVMGKILGE
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcatttaacaaaagggggacagctttaggagcagcaattgcatttgctttaaca
ttagcgcctaccttagtaatggctgaaacaagacaaattcctgaatctgaaacagtaaat
gttggattcataaaagatggagagagatcaacaatattcaatcaaaactggaagtttttt
aagggagatccttctggtgctgaaggggtagactttgatgattcttcatggagaggacta
aacttacctcatgattggagtattgaaggagattttactgttgaaggggaagctgaaagt
ggattcttattaggaggaactggatggtatcgtaaagcctttgtagttcctgaaaagtat
aatagtaaagattttacattaaactttgatggagtatatatgaatgctgaagtatatgta
aatggtaaaaaggttggtgagcataattatggatacacttcttttgcctttgatattact
gaagctttaatatgtgatggacaaactgaaaatataattgctgttaaggtatctaaccca
gtgccaactagtagatggtattctggaagtggaatttatcgtgatgtaactttaagtgta
acagattctattcatgttgcacattcaggaacaacagttactactccaaaacttgaagag
caaaaaggtggagacgtagatgtagctattgagacaattgttgaaaacgagtccaaagat
aattctatggttactgtaaaaagcacagtagtaaattctaagggagaagaagttagtgag
gccgtaataaatgaacagagtattggagttaatgaaagttatactttcaagcaaactgct
attgtaaataatcctgatttatggtcagttgataatccaaatatgtataaggtaaaaagt
gaagtattattagatggaaaggttatagatacttattttactgattttggatttagatat
tataattttgataaagatactggattctctttaaatggagaaaatatgaaattaaaaggt
gtttgtatgcaccatgaccaaggggctttaggagcagcatcttattatcgtgcagtagaa
cgtcaaatggagaaaatgaaggaaatgggagtaaatgcaatccgtgtttctcataatcct
gctagtgaaatgttattagagatttgtaatcgtttaggtttattagttattaatgaagcc
tttgatacatggacaaatccaaagaacggaaatgtaaatgacttttctaagtattttaat
gaagtaataggagaagataatgaaattttaaatggttctccagaaatgacatggggagag
tttgaagctagatctatggttaaaaactctaagaacaatccatctataataatgtggtca
ataggtaatgaggtattagaaggaattagtggaagtgcatctaattatactaacgtagct
caaaatataattgattggattaaggatgaggatgaaacaagacatgttactataggtgat
aatagaactaaaaatggagatagaacagcagaggctatttcagaggtggttgatgacaat
ggtggattagttggatttaactatgcaaatgagacacaggttgcacagcaaagagcaaac
catccagattggacattatatgcttctgaaaccagtagtgcaatacacactagaggatat
tataaaacaaagggaatagattatggaaatcatcgtatttcagagtatgataataatcaa
acaaaagttggttggggacattcagctagtgatgcttggaagtttgtaatcaaaaatgat
tataatgctggagaacttgtttggacaggatttgactatataggagaacctactccttgg
aatggtactggtacaggtacagttggtggaggaaatggagcagctccaaaatcaagttac
tttggtatagttgatactgcaggatttgaaaaagatatttattatttatatcaaagtcaa
tggaatgatgatgtaaatacattacatgtacttccaacatggaatagagaagatatagtt
atagaaaatggaaatgttgaagtaaacgtatttactgatgctcataaagttgaattatat
ctaaatgataaaaaagttggagagcaaacctcaactgagcatacaactgatgcaggatac
aaatattatacttttggaaatgattcattgtatccagtatttaatgttccttatgaagag
ggtaccttaactgctaaggcttatgataaagaaggaaatgaaatcacaaatacagaggga
agaaatacagtaaaaacaactggggaggcttctactgtaagattaagtgcagatagagat
actattgattcagatggatatgatttatcttatattactgtagatattgttgatgaagat
ggcaatatagttcaaaatgcagataatagattaaacttccaattagaaggggatggaaaa
attgtaggtgttgacaatggagatcaaactgatacagattcttataaacctacaagtgat
acagaagcttctagaaaagcattaagtggtaaggcattagtaatagttcaatcaactaag
gatgctggaaatataagattaaatgtttcaggtgagggattacaatctcaatctatagaa
attaatactgtaaataatgctggagaagataagttcttagaatcttatgaaatagttaaa
gattactatgttaatttaaatgaaaagccagagttaccaagtacagtagaaggaagatac
agtgatggaacaactgagacttttaatatttcatggaatgattatgatgaatcacaatta
aatactcctcaagtatttaagataaatggtaaattagaaggaacagatgtggctgtaaat
gtaaatgtccatgtaattggtgatgtggtttcaatggaaaattactcaacatttacttat
gctggacaaactccaacacttcctaagactgttaaaggatatttagctgatggaaatgaa
agtgaagagtttaaagtggattggaatttagaaggcgtagatttctctgagcctaataca
acagttgaagttttaggagaagtatccttattaggtaagacatatactgttacttcaaca
gtgcgtgtagttgaagctttaaaagctgctgctaacttagctataaataattcttctaac
aaagatgttcctgctttaagccaaagttgcgtttctacagctgataacttaaattctatt
aataatggaataactaataatagttcaaatacaggagaacgttggacaaactggaatgaa
agaaatttaacagagaatggtgaacctaaaggggcatatgttcaattagactggaaaaac
aaatataatatagatagactagatttatggttatttactgataatatttatggaagaatt
cctaagaaagttgaaataagttataaaaatgaagctggtgaatatgaggtagttactcat
tcaaatacaacagaggtatcataccttgctggagaaacaacttatttcttagataaagta
ataaatactgatagtattcgtgtttatatgcaacaacctgaagtaggtaagtgtattgga
ttatcagaggttgcagtatatgagtatgtaccacaagtaagtgctaatgaaggtaataaa
ttatctgaaataaaattagatggcgaagccttagaaggatttaatcctgatactaatgaa
tatacagttaatttaaaagaattacctaaaactgtagaagcttcaggggaagaaaatgtg
gctataactatattaccagttcataataataaatcaataatcattgctcgttcagaatct
ggtgctaaaaacatctatactgtaaattatgtattagaagaatctgaagggtcagcagat
attaatgaggatggttctataaatgtaggagatttatccatagtatctaaatatcaagga
gaggttatatcaggaaatgctttaagtgaaaaatctgatataaacaaagatggagtagta
gataaagctgatatccaaatagttatgggtaagatcttaggagaataa

DBGET integrated database retrieval system