KEGG   Clostridium perfringens 13: CPE1302Help
Entry
CPE1302           CDS       T00074                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpe  Clostridium perfringens 13
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPE1302
   01230 Biosynthesis of amino acids
    CPE1302
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPE1302
   00051 Fructose and mannose metabolism
    CPE1302
   00562 Inositol phosphate metabolism
    CPE1302
Enzymes [BR:cpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPE1302
Exosome [BR:cpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPE1302
  Exosomal proteins of bladder cancer cells
   CPE1302
  Exosomal proteins of melanoma cells
   CPE1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1541381..1542127)
Genome map
AA seq 248 aa AA seqDB search
MRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKV
GAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNL
TPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSD
QANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAA
DFAQIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaactccaataatcgcaggaaactggaaaatgcactatacaatagacgaggctgtt
aaattagttgaagaattaaagccattagttaaagatgctaaatgtgaagttgttgtttgc
ccaacttttgtttgcttagatgcagttaaaaaagctgttgaaggaacaaacataaaagta
ggtgctcaaaacatgcactttgaagaaaaaggagcattcactggagaaatcgctccaaga
atgttagaagctatgaacatagattacgttataattggacatagtgaaagaagagaatac
ttcaacgaaacagatgaaacttgcaacaaaaaagttaaagctgctttcgcacacaactta
actccaatcctttgctgtggagaaactttagagcaaagagaaaacggaactactaacgac
gttataaaagctcaaatcactgctgatttagaaggattaactaaagagcaagctgagaaa
gttgttatagcttacgaaccaatctgggctatcggaactggaaaaactgctacttcagac
caagctaatgaaacaatagctgctataagagctatggttgctgaaatgttcggacaagaa
gttgctgataaagtaagaatccaatacggtggatcagttaagcctaacacaatagcagag
caaatggctaaatcagacatcgatggtgctttagttggtggagctagcttagttgcagct
gactttgctcaaatcgtaaactactaa

DBGET integrated database retrieval system