KEGG   Clostridium perfringens 13: CPE1302Help
Entry
CPE1302           CDS       T00074                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00010  Glycolysis / Gluconeogenesis
cpe00051  Fructose and mannose metabolism
cpe00562  Inositol phosphate metabolism
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
cpe01120  Microbial metabolism in diverse environments
cpe01130  Biosynthesis of antibiotics
cpe01200  Carbon metabolism
cpe01230  Biosynthesis of amino acids
Module
cpe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPE1302
   00051 Fructose and mannose metabolism
    CPE1302
   00562 Inositol phosphate metabolism
    CPE1302
Enzymes [BR:cpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPE1302
Exosome [BR:cpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPE1302
  Exosomal proteins of bladder cancer cells
   CPE1302
  Exosomal proteins of melanoma cells
   CPE1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAB81008
UniProt: Q8XKU1
Structure
PDB: 

Jmol
Position
complement(1541381..1542127)
Genome map
AA seq 248 aa AA seqDB search
MRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKV
GAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNL
TPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSD
QANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAA
DFAQIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaactccaataatcgcaggaaactggaaaatgcactatacaatagacgaggctgtt
aaattagttgaagaattaaagccattagttaaagatgctaaatgtgaagttgttgtttgc
ccaacttttgtttgcttagatgcagttaaaaaagctgttgaaggaacaaacataaaagta
ggtgctcaaaacatgcactttgaagaaaaaggagcattcactggagaaatcgctccaaga
atgttagaagctatgaacatagattacgttataattggacatagtgaaagaagagaatac
ttcaacgaaacagatgaaacttgcaacaaaaaagttaaagctgctttcgcacacaactta
actccaatcctttgctgtggagaaactttagagcaaagagaaaacggaactactaacgac
gttataaaagctcaaatcactgctgatttagaaggattaactaaagagcaagctgagaaa
gttgttatagcttacgaaccaatctgggctatcggaactggaaaaactgctacttcagac
caagctaatgaaacaatagctgctataagagctatggttgctgaaatgttcggacaagaa
gttgctgataaagtaagaatccaatacggtggatcagttaagcctaacacaatagcagag
caaatggctaaatcagacatcgatggtgctttagttggtggagctagcttagttgcagct
gactttgctcaaatcgtaaactactaa

DBGET integrated database retrieval system