KEGG   Clostridium perfringens 13: CPE1344Help
Entry
CPE1344           CDS       T00074                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cpe  Clostridium perfringens 13
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpe00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cpe00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(1587084..1588106)
Genome map
AA seq 340 aa AA seqDB search
MVIESKINDEISKIILKNNKVSVEILNLGAIVEKINVEDRYGNKENIVLAYKDEESYIEN
PSSLGSIVGRVAGRIGKGSFKLNGINYELDKNNNGNCLHGGYKGFSKKIWDYSYSEDEEK
STAIFTSFSKDGEGGFPGNLKVQVTYSLEGDKLSIEYRASSDKDTVVNLTNHSYFNLSGN
NKRNVLEQKLYIDSDKICELDKDLIPTGEFLSVEKTPFDFRKLKKIGEDINKNHLQLEIG
SGYDHPWVLNKKGDFDAILVDEESGRIMKVKTDQKAVVCYSMNFPDELPLENGKVAKKHD
GICFETQNLPVGYDDCFLDGIILKKDEEYYQKTTFEFEYM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttggttatagaaagtaaaattaatgatgaaataagtaaaataatattaaaaaataataaa
gtatctgtggaaatattaaacttaggtgctattgtagaaaaaataaatgtagaggataga
tatggaaataaagaaaatatagtgcttgcatataaggatgaggaaagctatattgaaaat
ccttcaagtttaggttctatagtaggaagagtagcaggtagaataggaaagggttccttt
aaattaaatggtattaattatgaattagataaaaataataatggaaactgccttcatgga
gggtataaaggttttagtaaaaaaatctgggattattcatatagtgaagatgaagaaaaa
tctacagcaatatttacttcttttagtaaggatggagaagggggattcccaggaaattta
aaggttcaggttacttattctctagaaggagacaagctttccatagaatatagagcttct
tcagataaagatacagtagtaaatttaactaatcattcatattttaatttatcaggaaat
aataaaagaaatgtattagaacaaaagctttatatagattcagataaaatatgtgagtta
gataaagatttaattccaacaggagagtttttaagtgtagaaaaaacaccttttgacttt
aggaagttaaaaaaaataggtgaggatataaataaaaaccacttgcaattagaaattgga
tcaggatatgatcatccatgggttttaaataagaagggtgattttgatgcaatcttagta
gatgaagaatcaggaagaattatgaaggttaagacagatcaaaaggcagtagtatgttat
tcaatgaattttccagatgaattacctttagaaaatggcaaagtagccaaaaagcatgat
ggaatatgttttgaaacacaaaacttaccagtaggatatgatgattgcttcttagatgga
ataatacttaaaaaggatgaagagtattatcaaaaaacaacttttgaatttgagtatatg
taa

DBGET integrated database retrieval system