KEGG   Clostridium perfringens 13: CPE1344Help
Entry
CPE1344           CDS       T00074                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
cpe  Clostridium perfringens 13
Pathway
cpe00010  Glycolysis / Gluconeogenesis
cpe00052  Galactose metabolism
cpe01100  Metabolic pathways
cpe01110  Biosynthesis of secondary metabolites
cpe01120  Microbial metabolism in diverse environments
cpe01130  Biosynthesis of antibiotics
Module
cpe_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPE1344
   00052 Galactose metabolism
    CPE1344
Enzymes [BR:cpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     CPE1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Lipocalin_4
Motif
Other DBs
NCBI-ProteinID: BAB81050
UniProt: Q8XKQ0
Position
complement(1587084..1588106)
Genome map
AA seq 340 aa AA seqDB search
MVIESKINDEISKIILKNNKVSVEILNLGAIVEKINVEDRYGNKENIVLAYKDEESYIEN
PSSLGSIVGRVAGRIGKGSFKLNGINYELDKNNNGNCLHGGYKGFSKKIWDYSYSEDEEK
STAIFTSFSKDGEGGFPGNLKVQVTYSLEGDKLSIEYRASSDKDTVVNLTNHSYFNLSGN
NKRNVLEQKLYIDSDKICELDKDLIPTGEFLSVEKTPFDFRKLKKIGEDINKNHLQLEIG
SGYDHPWVLNKKGDFDAILVDEESGRIMKVKTDQKAVVCYSMNFPDELPLENGKVAKKHD
GICFETQNLPVGYDDCFLDGIILKKDEEYYQKTTFEFEYM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttggttatagaaagtaaaattaatgatgaaataagtaaaataatattaaaaaataataaa
gtatctgtggaaatattaaacttaggtgctattgtagaaaaaataaatgtagaggataga
tatggaaataaagaaaatatagtgcttgcatataaggatgaggaaagctatattgaaaat
ccttcaagtttaggttctatagtaggaagagtagcaggtagaataggaaagggttccttt
aaattaaatggtattaattatgaattagataaaaataataatggaaactgccttcatgga
gggtataaaggttttagtaaaaaaatctgggattattcatatagtgaagatgaagaaaaa
tctacagcaatatttacttcttttagtaaggatggagaagggggattcccaggaaattta
aaggttcaggttacttattctctagaaggagacaagctttccatagaatatagagcttct
tcagataaagatacagtagtaaatttaactaatcattcatattttaatttatcaggaaat
aataaaagaaatgtattagaacaaaagctttatatagattcagataaaatatgtgagtta
gataaagatttaattccaacaggagagtttttaagtgtagaaaaaacaccttttgacttt
aggaagttaaaaaaaataggtgaggatataaataaaaaccacttgcaattagaaattgga
tcaggatatgatcatccatgggttttaaataagaagggtgattttgatgcaatcttagta
gatgaagaatcaggaagaattatgaaggttaagacagatcaaaaggcagtagtatgttat
tcaatgaattttccagatgaattacctttagaaaatggcaaagtagccaaaaagcatgat
ggaatatgttttgaaacacaaaacttaccagtaggatatgatgattgcttcttagatgga
ataatacttaaaaaggatgaagagtattatcaaaaaacaacttttgaatttgagtatatg
taa

DBGET integrated database retrieval system