KEGG   Clostridium perfringens 13: CPE1364Help
Entry
CPE1364           CDS       T00074                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cpe  Clostridium perfringens 13
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPE1364
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPE1364
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CPE1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(1607193..1611608)
Genome map
AA seq 1471 aa AA seqDB search
MKRLIACGIAASIVSVNGLSVLASELNKSDKVNLALNKKTVASSREVNDKWGAELITDGI
KDKPSDPNAKPGNSRWASSRSVPQWIYIDFEEATTFDQVDILWDGAYSRNYKLEVSNDGE
TWEEVYATSEGKGNQESINLGEDITANYLRVSCEDTAHEWGNVSIYEVEVYDNENEENVT
PPETEIGVNIALNKTATASASETNTLTPDKVVDGDTSSRNSRWSSGGFSNGAKQWITIDL
EKESTFDKVRLFWEAANAKVYEIQTSNDNENWKTVHRNEAGKGGTEVIELSEKENARYVR
VYCEKNNPAVWNAVSLYEVEIYNGEIPSSGDLDEVLNSLEVPTINKGDSKLQMPEVPKGF
EIKFIGADYNQIINDDMTINEPLVDTKVVVDFEIKKGSLKRETTGIEITVPGKYSGSLGS
NTKPEVVPSLREWIGKDGNFTIRDSSRIVIDPTYENELSKTASEFKSDYEEIVGKPIEIV
YSSSPVEGDFYFTLNCEDKSIGEEGYYMYVDEYVKVEATHNTGAFYSTRSILQILKQNGE
TIQKGIVRDFPRYENRGFMLDVGRKFFTMDYLEQFMEAMSWYKLNNFQVHLSDNYIWTNN
ENWETAYAAFRLESETYPGLTATDGSYTKEEFREFIEKSGDHGVEIIPEIDVPAHSLAFT
RYDQSLALGTGGDATYLDVGNPKVYDFVDGLFDEYLGGENPVFGDQDFHIGTDEYKGAPE
KKEEFRAFTDRYLKRVRDDYGRNPRLWGSLDVFPGQTPVTSDGVLMNIWYRGYADARNMI
NQGYDILNTQDADLYIVPEAGYYNNYLNTRFLYNEWEPRRFASDYKLPAGHPQLKGGMFA
VWNDMIDEKANGISERDIYDRSFQAAQVLSEKMWAAPDSETSFEEFKERVDKVSDVPDSN
LTYDVESKTETVIDYDFEEDSTENIKDNSGNEYNATGTNVESVEGKEGKGIKLSGGESYI
DTPIDNKGLDYTVSMWVKKDANGDYSEQILSESNTGVLKACQKETGNVGFSREGYDYSFN
YKLPEGEWVELTFIGELNKTSLYVNGEFIETINKSNGGKVGTFILPLDKIGSSTNSFKGS
IDEITIKDGAHKIADPTVIPQEQMSATASSEHPNIGSEGIADFAIDGDESTIWHTKWSPV
EALPQHITLDLGGSYNINKFTYMPRQDALNGSISKYEFQVSTDGENFTKVLEGDWTADHS
TKVLKFDPVEATHVRLVAKAGHGGFASAAELNVHQVLEVPEENVGQSFLTLPESVKVNEN
FDVFLGANEIKEDLSAYAAEFTLKYNPEVFDLVEVTNGIDGVLVNYKEVEPGVVKILAAS
LGNPIENSTNLVKATLTPKSESEREIFEVISANLGDGENGKVYELGLTSGEVVVGKGSAE
IIVNPVENFVASEVSRKYVNVTWEAPKTTEGLEGYILYKDGKKVGEVGADETTYKFKGLN
RHTIYNFKIAAKYSNGEISSKKSITLRTSRN
NT seq 4416 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggttaatagcttgtggaatagcagcaagtatagtttcagttaatggattatct
gttcttgcttctgagttaaataagtcagataaagttaatttagctttaaacaaaaaaact
gttgcctcttcaagagaagttaatgacaaatggggtgcagaattaataactgatggtatt
aaggataagccaagtgatccgaatgctaagccaggaaattctaggtgggctagttcaaga
agtgtaccacaatggatatacattgattttgaagaagcaacaacctttgatcaagttgat
atactttgggatggtgcatattcaagaaattataaattagaggtttctaatgatggggaa
acttgggaagaagtttacgcaactagtgaggggaaaggaaatcaagagtctataaatctt
ggagaagatataactgctaattatttaagagttagttgtgaagatacagctcatgaatgg
ggaaatgtatcaatatatgaagttgaggtttatgataacgaaaatgaggaaaatgtaact
cctccagaaacagagataggagttaatattgctttaaataaaactgctacggcatcagca
tcagaaactaatacacttactccagacaaagttgtagatggagatacatcttcaagaaat
tcaagatggtcaagtggaggattttctaatggtgctaaacagtggataactattgaccta
gaaaaggaaagcacttttgacaaggttagattattctgggaagctgccaacgctaaggtc
tatgaaattcaaacttccaatgataatgaaaattggaaaacagttcatagaaatgaagct
ggaaaaggtggcactgaggttatagaattaagtgaaaaagaaaatgcaaggtatgtaaga
gtttattgtgaaaaaaataatccagcagtatggaatgcagtatctttatatgaagtagag
atatataatggagagattccttcatctggtgatttagatgaagttttaaactcattagaa
gttcctactataaataagggggactctaaacttcaaatgccagaggttccaaaagggttt
gagataaaatttattggggcagattataatcaaataataaatgatgatatgaccataaat
gaacctttagtagatacaaaggtagttgtggattttgaaataaaaaaaggcagtctaaaa
agagaaactactggtatagaaataactgtacctggtaaatattctggttctttaggaagt
aatactaagccagaagtagttccaagtttaagagaatggattggaaaagatggaaacttt
actataagagattcttcaagaatagttattgatcctacctatgaaaatgaactaagcaaa
actgcaagtgaatttaaatctgattatgaggagatagttggtaaaccaattgaaatagtt
tactcaagttcacctgtagaaggagatttttattttactttaaattgtgaagataagagt
attggagaagaaggatattatatgtatgtagatgagtacgtgaaagttgaagctactcac
aatacaggagctttctactcaactagatcaatacttcaaatattaaagcaaaatggagaa
actattcaaaaaggaatagttagagacttcccaagatatgaaaatagaggatttatgctt
gatgttggaagaaaattctttacaatggattatttagagcagtttatggaagctatgtct
tggtacaaattaaataacttccaagttcatttaagtgataactatatttggactaataat
gagaattgggaaactgcttatgctgcttttagattagaatctgaaacatatccaggttta
acagcaacagatggaagttatactaaagaagaatttagagaatttatagaaaagtctggg
gatcatggagtagaaattattccagaaatagatgttcctgctcactccttagcatttact
cgctatgatcaatctttagccttaggtacaggaggagatgcaacttatttagatgtaggt
aatccaaaggtttatgattttgtagatggattatttgatgaatatttaggaggagaaaat
ccagtctttggagatcaagatttccatattggaacagatgagtataagggagcacctgag
aaaaaagaagaatttagagcatttacagatagatatcttaaaagagtaagagatgattat
ggtagaaatccaagactatggggaagtttagatgttttcccaggacaaactcctgtaact
agcgatggagtccttatgaatatatggtataggggatatgctgatgctagaaatatgata
aatcaaggatatgatattttaaatacacaggatgcagatctttatatagttccagaagca
ggttactataataactatcttaacacaagatttttatataatgagtgggaaccaagaaga
tttgcttcagattacaaacttccagcgggacatcctcaattaaagggaggaatgtttgct
gtatggaatgatatgatagatgaaaaagccaatggaatatctgaaagagacatctatgat
agatcattccaggcagctcaagttttatcagaaaaaatgtgggcggcacctgatagtgaa
acaagctttgaagagtttaaagaaagagttgacaaagtaagtgatgttccagattctaac
ttaacttatgatgtagaatctaaaactgaaactgtaattgattatgattttgaagaagat
tctacagaaaatattaaagataattctggaaatgaatataatgctacaggaacaaatgta
gaatctgtagaaggtaaagaaggaaaaggaattaaattaagtggaggagaaagttatatt
gatactccaattgataacaaaggtttagactatacagtttctatgtgggtgaaaaaagat
gcaaatggagattatagtgagcaaatattatcagaatctaacacaggggtattaaaggct
tgtcaaaaagaaactggtaatgttggtttctcaagagaaggatatgactattcatttaat
tataaattacctgagggtgaatgggtagagttaacctttattggagaattaaataaaaca
agtctttatgtaaatggagaatttatagaaactataaataagagtaatggtggtaaggta
ggaacatttattttacctttagataaaataggaagttcaactaattcctttaagggtagc
atagatgaaattactattaaggatggcgctcataaaattgcagatcctacagttatacct
caagagcaaatgagtgcaactgctagcagtgagcatcctaatataggatcagagggaata
gctgattttgctatagatggagacgaaagtactatatggcatactaaatggagtcctgta
gaagcattacctcaacacattactttagacttaggtggaagttataatataaataaattt
acttatatgccaagacaagatgccttaaatggtagcataagtaaatatgaattccaagtt
agtactgatggagaaaactttacaaaggttttagagggagattggactgctgaccatagt
actaaggtattaaaatttgatccagtagaagctactcatgtaagattagtggctaaagct
ggtcatggtggatttgcctcagctgctgaattaaatgttcatcaagttttagaggttcca
gaggaaaatgtgggtcaaagtttcttaactttaccagaaagtgttaaagtaaatgagaat
tttgatgttttcttaggtgctaatgaaataaaagaagatttatcagcttatgcagcagaa
tttactttaaaatataatccagaagtatttgatttagttgaagttacaaatggaatagat
ggagttttagtaaattataaagaagtagaaccaggcgtagtaaaaatattagctgctagc
ttaggaaatcctatagaaaattctacaaacttagtaaaggcaacacttactcctaagagt
gaatcagaaagagaaatttttgaagtaatttcagcaaacttaggtgatggagaaaatgga
aaggtttatgaattaggattaacaagtggagaggtagtagtaggcaaaggtagtgcagag
ataattgttaacccagtagaaaactttgtggcttcagaggttagtagaaaatatgtaaat
gtaacttgggaagctccaaagacaactgaaggtttagaaggatatattctatataaagat
ggtaaaaaggttggagaagttggcgctgatgagacaacttataaatttaaaggcttaaat
agacacacaatttacaactttaaaatagctgctaagtattcaaatggagaaatttctagt
aagaagtcaataactttaagaacaagcagaaattag

DBGET integrated database retrieval system