KEGG   Clostridium perfringens 13: CPE1467Help
Entry
CPE1467           CDS       T00074                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpe  Clostridium perfringens 13
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPE1467 (pfk)
   01230 Biosynthesis of amino acids
    CPE1467 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPE1467 (pfk)
   00030 Pentose phosphate pathway
    CPE1467 (pfk)
   00051 Fructose and mannose metabolism
    CPE1467 (pfk)
   00052 Galactose metabolism
    CPE1467 (pfk)
  Energy metabolism
   00680 Methane metabolism
    CPE1467 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPE1467 (pfk)
Enzymes [BR:cpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPE1467 (pfk)
Protein phosphatases and associated proteins [BR:cpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPE1467 (pfk)
Messenger RNA biogenesis [BR:cpe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CPE1467 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1723470..1724672
Genome map
AA seq 400 aa AA seqDB search
MNCIIAQSGGPTSVINASVYGLVKANKKLNLYENVYGGLNGIEGILNKKIINLSDLDELQ
LERFKNSPASGLGSCRYKLKPLSESEDEYLKLLDILNSLNIKAFFYVGGNDSMDTTAKLN
AFAKAKNIDIKFFGIPKTIDNDLMHTDHTPGFGSAAKFISTAVLETYLDSKVYTNNGIFI
IETMGRDTGWLAASGALATINGNKCADLVYLPERAFSVQSFLTDVARIFKEKKHVYIVAS
EGLKDENGKFLTETAPNDDSFGHAQLGGVGAYLKNLIIQASITHRVKSLELNTLQRCSMH
ASSKIDVNEAVMVGQAALEASINSEGGYMVAIRRDSSFPYKSSTFLIEADKIANNIKYFP
SEWINEEGNNITEEGLLYLKPLISDFEDRDSLPLYHSFVL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtattatagctcagtctggcggacctacttcagtaataaatgctagtgtttat
ggtctagttaaagcaaataaaaaacttaatttatatgagaatgtttatggtggattaaac
ggaatagaaggtattttaaataagaaaataataaacctttcagaccttgatgaacttcaa
ttagaaagatttaaaaattcaccagcctctggtttaggttcttgtagatataaattaaaa
cctcttagcgaaagtgaagatgagtacttaaaacttttagatattttaaactcacttaat
ataaaagctttcttttatgtaggtggaaatgactcaatggatactactgctaaattaaat
gcttttgcaaaagctaaaaatatagatataaaattctttggaatccctaaaacaatagat
aatgatttaatgcacacagatcacactccaggatttggtagcgctgcaaaattcatatct
acagcagttttagaaacttatttagactcaaaagtttatactaataatggaattttcata
attgaaactatgggaagagatacaggttggttagcagcttctggtgccttagcaactata
aacgggaataaatgtgctgatttagtatatttacctgaaagagcattttcagtacaaagc
tttttaactgatgtagctagaatatttaaagaaaaaaaacatgtatatatagtagcttct
gaaggattaaaagatgaaaatggaaagtttcttactgaaactgcaccaaatgacgattca
tttggacatgctcaattaggtggtgtaggtgcttacttaaagaacctaataatccaagct
agtataacacatagagttaaatctctagaacttaatactctacaaagatgttctatgcat
gcttcatctaaaatagatgtaaatgaagctgttatggtaggacaagctgccttagaagct
tctattaattcagaaggtggttatatggttgctataagaagagattcttcattcccatat
aaaagctctacttttttaattgaagctgataaaatagctaataatataaaatattttcca
agtgaatggataaatgaagaaggtaataatataaccgaagaaggtttattatatcttaag
ccattaattagcgattttgaggatagagattctcttcctctttatcatagttttgtttta
taa

DBGET integrated database retrieval system